Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T1Z3

Protein Details
Accession A0A086T1Z3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-84RAVPKNKTSHSRKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
74-77RKRH
Subcellular Location(s) mito 11, extr 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAVAAPLLPRLVVPGFPSISRWATSYTSRYAVPFLPALSIALPGISLNIPGLLGDIWEGILRAVPKNKTSHSRKRHRQMAGKALKDVNHLCRCPGCGAIKRTHRLCQNCLEDFRRIWRQDSGGAPPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.17
4 0.17
5 0.2
6 0.21
7 0.22
8 0.22
9 0.21
10 0.2
11 0.22
12 0.25
13 0.27
14 0.26
15 0.26
16 0.26
17 0.25
18 0.24
19 0.22
20 0.2
21 0.17
22 0.14
23 0.13
24 0.12
25 0.12
26 0.1
27 0.09
28 0.07
29 0.06
30 0.05
31 0.04
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.06
51 0.1
52 0.11
53 0.14
54 0.17
55 0.2
56 0.28
57 0.36
58 0.46
59 0.53
60 0.62
61 0.69
62 0.77
63 0.82
64 0.81
65 0.82
66 0.79
67 0.79
68 0.77
69 0.68
70 0.62
71 0.55
72 0.48
73 0.43
74 0.39
75 0.38
76 0.36
77 0.34
78 0.33
79 0.32
80 0.33
81 0.3
82 0.32
83 0.29
84 0.3
85 0.34
86 0.41
87 0.48
88 0.53
89 0.56
90 0.58
91 0.6
92 0.58
93 0.58
94 0.59
95 0.58
96 0.56
97 0.58
98 0.55
99 0.51
100 0.47
101 0.51
102 0.51
103 0.46
104 0.44
105 0.43
106 0.43
107 0.44
108 0.47
109 0.45