Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F8J5

Protein Details
Accession A7F8J5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-214LVRAMRKERRAKIKEGNYLKHydrophilic
NLS Segment(s)
PositionSequence
140-155KSKKLRRAAAKARRKA
201-206KERRAK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG ssl:SS1G_13926  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MICSRCLSRRPFSHLSTQSRTFTSTPLLLSVPPTSTPSSPRTVSPPTATSTGAAQPFSTPLSPSPAALGISSSPSHKKPAPIPTSSIPAGTILKGLNYLKGRDDPVALKEEEYPEWLWKCLDEKKLVEGTGDAGGDEFSKSKKLRRAAAKARRKAEERALLSGDTSLLEVKVPFQQQSIDLPTSGEEALDQRAELVRAMRKERRAKIKEGNYLKGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.67
4 0.66
5 0.6
6 0.54
7 0.54
8 0.44
9 0.37
10 0.33
11 0.28
12 0.23
13 0.22
14 0.21
15 0.18
16 0.19
17 0.19
18 0.16
19 0.15
20 0.18
21 0.18
22 0.19
23 0.23
24 0.25
25 0.28
26 0.28
27 0.29
28 0.32
29 0.34
30 0.36
31 0.36
32 0.34
33 0.32
34 0.33
35 0.32
36 0.26
37 0.23
38 0.24
39 0.21
40 0.19
41 0.16
42 0.14
43 0.15
44 0.16
45 0.14
46 0.11
47 0.1
48 0.17
49 0.17
50 0.16
51 0.16
52 0.16
53 0.16
54 0.15
55 0.14
56 0.08
57 0.1
58 0.11
59 0.12
60 0.14
61 0.14
62 0.19
63 0.2
64 0.24
65 0.28
66 0.38
67 0.41
68 0.39
69 0.42
70 0.4
71 0.43
72 0.39
73 0.33
74 0.23
75 0.19
76 0.18
77 0.13
78 0.12
79 0.08
80 0.07
81 0.1
82 0.09
83 0.13
84 0.13
85 0.14
86 0.14
87 0.16
88 0.17
89 0.16
90 0.17
91 0.14
92 0.14
93 0.17
94 0.15
95 0.14
96 0.14
97 0.15
98 0.13
99 0.14
100 0.13
101 0.13
102 0.13
103 0.13
104 0.12
105 0.11
106 0.15
107 0.18
108 0.21
109 0.22
110 0.22
111 0.25
112 0.28
113 0.27
114 0.24
115 0.18
116 0.16
117 0.14
118 0.13
119 0.09
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.05
126 0.11
127 0.13
128 0.18
129 0.25
130 0.3
131 0.38
132 0.47
133 0.57
134 0.62
135 0.72
136 0.77
137 0.78
138 0.78
139 0.76
140 0.7
141 0.65
142 0.63
143 0.61
144 0.54
145 0.49
146 0.45
147 0.39
148 0.36
149 0.31
150 0.22
151 0.13
152 0.11
153 0.07
154 0.06
155 0.06
156 0.06
157 0.07
158 0.12
159 0.14
160 0.14
161 0.14
162 0.16
163 0.17
164 0.21
165 0.25
166 0.21
167 0.2
168 0.19
169 0.19
170 0.2
171 0.18
172 0.13
173 0.09
174 0.09
175 0.11
176 0.11
177 0.1
178 0.1
179 0.11
180 0.12
181 0.13
182 0.16
183 0.2
184 0.25
185 0.33
186 0.39
187 0.47
188 0.57
189 0.65
190 0.71
191 0.7
192 0.74
193 0.77
194 0.79
195 0.8
196 0.78