Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086T5M6

Protein Details
Accession A0A086T5M6    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPPRASRNPRPPSRSRFQEGSHydrophilic
101-126MEKLRIKRDPAPEKKQQQRKDMPAPPHydrophilic
NLS Segment(s)
PositionSequence
108-108R
110-116PAPEKKQ
245-249KKLRK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MAPPRASRNPRPPSRSRFQEGSMNDRTSTVPPVRFIGPDDRMSLEERKRPDVIDTIRPVVSEDVATSAPPPLQQQQQQQQTGTLGKRGSKQFLGQVWGGVMEKLRIKRDPAPEKKQQQRKDMPAPPPPPPPAGDRPSRDDVYANYQQLVNSGFFASHAIQSTRQPGPTRPSTSAGHHPSSPACAAPPQPPPLWPLHQPPARPTRNHPSSPIQSPTSASSRGTKRAVDPNADDDNDDDEDHPKSHKKLRKTASATRNLAIPRVRSSSRLAAARRSVSAANAPQREPNKLTKRVLGLQAPPPPPPARGSSAKRDGGSRTFGLERPRLHGGDGSRSGAAAAAAAAAALVSAGTGDRVLRPRRSAAEPLRVRPDANRGIPSVPDIPAKFTYGEDRENAGPWRGLRRNHANSFYNSTSGGSAIGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.8
4 0.75
5 0.69
6 0.69
7 0.63
8 0.62
9 0.6
10 0.53
11 0.46
12 0.42
13 0.4
14 0.34
15 0.37
16 0.35
17 0.31
18 0.3
19 0.33
20 0.34
21 0.33
22 0.34
23 0.36
24 0.34
25 0.33
26 0.34
27 0.32
28 0.32
29 0.35
30 0.39
31 0.37
32 0.38
33 0.4
34 0.42
35 0.42
36 0.42
37 0.41
38 0.42
39 0.41
40 0.44
41 0.45
42 0.43
43 0.42
44 0.41
45 0.39
46 0.31
47 0.26
48 0.18
49 0.13
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.11
57 0.15
58 0.17
59 0.24
60 0.3
61 0.39
62 0.47
63 0.55
64 0.57
65 0.55
66 0.51
67 0.48
68 0.48
69 0.4
70 0.35
71 0.29
72 0.29
73 0.35
74 0.38
75 0.39
76 0.35
77 0.37
78 0.38
79 0.39
80 0.39
81 0.33
82 0.29
83 0.24
84 0.23
85 0.2
86 0.15
87 0.12
88 0.1
89 0.15
90 0.18
91 0.22
92 0.23
93 0.27
94 0.34
95 0.44
96 0.52
97 0.58
98 0.62
99 0.68
100 0.76
101 0.81
102 0.84
103 0.81
104 0.8
105 0.8
106 0.81
107 0.81
108 0.79
109 0.76
110 0.76
111 0.72
112 0.67
113 0.64
114 0.57
115 0.49
116 0.43
117 0.42
118 0.41
119 0.42
120 0.44
121 0.42
122 0.46
123 0.49
124 0.48
125 0.42
126 0.36
127 0.33
128 0.33
129 0.35
130 0.29
131 0.24
132 0.24
133 0.23
134 0.23
135 0.23
136 0.15
137 0.1
138 0.09
139 0.08
140 0.08
141 0.1
142 0.1
143 0.09
144 0.1
145 0.11
146 0.12
147 0.14
148 0.2
149 0.2
150 0.22
151 0.22
152 0.24
153 0.3
154 0.35
155 0.38
156 0.35
157 0.38
158 0.37
159 0.39
160 0.44
161 0.43
162 0.38
163 0.33
164 0.32
165 0.28
166 0.28
167 0.25
168 0.16
169 0.11
170 0.11
171 0.13
172 0.17
173 0.2
174 0.22
175 0.22
176 0.22
177 0.24
178 0.26
179 0.27
180 0.26
181 0.27
182 0.32
183 0.34
184 0.34
185 0.37
186 0.43
187 0.44
188 0.43
189 0.43
190 0.46
191 0.5
192 0.5
193 0.49
194 0.46
195 0.46
196 0.48
197 0.46
198 0.37
199 0.3
200 0.3
201 0.28
202 0.24
203 0.21
204 0.18
205 0.21
206 0.22
207 0.26
208 0.27
209 0.26
210 0.27
211 0.34
212 0.36
213 0.33
214 0.31
215 0.32
216 0.33
217 0.32
218 0.28
219 0.2
220 0.2
221 0.17
222 0.16
223 0.11
224 0.1
225 0.11
226 0.12
227 0.13
228 0.14
229 0.17
230 0.26
231 0.31
232 0.37
233 0.45
234 0.51
235 0.59
236 0.63
237 0.69
238 0.7
239 0.74
240 0.69
241 0.6
242 0.58
243 0.48
244 0.44
245 0.37
246 0.29
247 0.24
248 0.26
249 0.26
250 0.24
251 0.28
252 0.3
253 0.32
254 0.35
255 0.33
256 0.33
257 0.37
258 0.36
259 0.33
260 0.29
261 0.25
262 0.21
263 0.24
264 0.24
265 0.27
266 0.28
267 0.28
268 0.31
269 0.33
270 0.37
271 0.36
272 0.41
273 0.43
274 0.48
275 0.5
276 0.48
277 0.51
278 0.52
279 0.53
280 0.47
281 0.43
282 0.41
283 0.47
284 0.44
285 0.4
286 0.4
287 0.36
288 0.33
289 0.31
290 0.29
291 0.27
292 0.34
293 0.38
294 0.43
295 0.5
296 0.52
297 0.5
298 0.49
299 0.47
300 0.43
301 0.42
302 0.33
303 0.29
304 0.28
305 0.3
306 0.33
307 0.35
308 0.33
309 0.33
310 0.37
311 0.33
312 0.32
313 0.32
314 0.29
315 0.31
316 0.32
317 0.3
318 0.25
319 0.24
320 0.23
321 0.2
322 0.17
323 0.09
324 0.06
325 0.04
326 0.04
327 0.03
328 0.03
329 0.02
330 0.02
331 0.02
332 0.02
333 0.02
334 0.02
335 0.02
336 0.03
337 0.03
338 0.04
339 0.09
340 0.17
341 0.23
342 0.28
343 0.32
344 0.37
345 0.42
346 0.47
347 0.52
348 0.53
349 0.58
350 0.59
351 0.61
352 0.64
353 0.6
354 0.55
355 0.49
356 0.5
357 0.48
358 0.47
359 0.44
360 0.39
361 0.39
362 0.39
363 0.4
364 0.34
365 0.27
366 0.29
367 0.26
368 0.28
369 0.29
370 0.3
371 0.27
372 0.25
373 0.31
374 0.29
375 0.32
376 0.29
377 0.31
378 0.3
379 0.33
380 0.34
381 0.29
382 0.28
383 0.28
384 0.36
385 0.38
386 0.42
387 0.48
388 0.56
389 0.63
390 0.67
391 0.73
392 0.68
393 0.67
394 0.71
395 0.63
396 0.54
397 0.45
398 0.38
399 0.31
400 0.26