Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SU82

Protein Details
Accession A0A086SU82    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-53APTPAPAPTPRPKRRRRAKTRASEETSVSHydrophilic
NLS Segment(s)
PositionSequence
32-45PTPRPKRRRRAKTR
Subcellular Location(s) nucl 14, cyto 7, pero 3, mito 2
Family & Domain DBs
Amino Acid Sequences MSDTDGNANYELFRDCLSAAIVRAAPTPAPAPTPRPKRRRRAKTRASEETSVSSVSASASGTGTDPDRDAEELADFIDYLASEMFDSFPDDLRELSLGCWRDSPYMQTQYALPLTAEDSFSDMNLPLTITETLRTYNLIAPDPTLDSPLPATAERFLIPVLTGYITSLTTPPPADYSTRADACEICGRWWIPLSYHHLIPRFVHDKAVKRGWHRKEDLQNVAWLCGACHRFVHHFKGHEELARDYHTVELLLEAEEVQRWAAWVSKLRWKGGGVRGRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.14
5 0.14
6 0.13
7 0.16
8 0.16
9 0.15
10 0.17
11 0.17
12 0.15
13 0.15
14 0.16
15 0.14
16 0.17
17 0.19
18 0.25
19 0.34
20 0.45
21 0.53
22 0.62
23 0.71
24 0.78
25 0.87
26 0.91
27 0.92
28 0.92
29 0.93
30 0.93
31 0.93
32 0.93
33 0.88
34 0.8
35 0.71
36 0.63
37 0.54
38 0.43
39 0.33
40 0.22
41 0.15
42 0.12
43 0.11
44 0.07
45 0.07
46 0.06
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.1
53 0.1
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.09
60 0.09
61 0.08
62 0.06
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.07
74 0.07
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.12
84 0.13
85 0.13
86 0.14
87 0.15
88 0.17
89 0.17
90 0.2
91 0.22
92 0.26
93 0.25
94 0.24
95 0.23
96 0.24
97 0.24
98 0.2
99 0.13
100 0.08
101 0.09
102 0.09
103 0.09
104 0.07
105 0.08
106 0.07
107 0.07
108 0.08
109 0.07
110 0.06
111 0.06
112 0.06
113 0.04
114 0.06
115 0.07
116 0.06
117 0.07
118 0.07
119 0.08
120 0.08
121 0.09
122 0.08
123 0.09
124 0.11
125 0.11
126 0.1
127 0.1
128 0.1
129 0.11
130 0.1
131 0.1
132 0.08
133 0.08
134 0.08
135 0.08
136 0.09
137 0.08
138 0.08
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.07
145 0.06
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.06
155 0.06
156 0.07
157 0.08
158 0.08
159 0.09
160 0.1
161 0.11
162 0.14
163 0.18
164 0.22
165 0.22
166 0.22
167 0.21
168 0.2
169 0.22
170 0.25
171 0.21
172 0.16
173 0.19
174 0.19
175 0.19
176 0.21
177 0.18
178 0.14
179 0.18
180 0.25
181 0.25
182 0.27
183 0.3
184 0.31
185 0.32
186 0.31
187 0.34
188 0.3
189 0.28
190 0.32
191 0.33
192 0.38
193 0.44
194 0.5
195 0.47
196 0.51
197 0.61
198 0.62
199 0.66
200 0.64
201 0.66
202 0.68
203 0.72
204 0.71
205 0.62
206 0.59
207 0.51
208 0.46
209 0.38
210 0.29
211 0.2
212 0.2
213 0.2
214 0.16
215 0.16
216 0.19
217 0.25
218 0.3
219 0.37
220 0.37
221 0.4
222 0.4
223 0.44
224 0.44
225 0.4
226 0.39
227 0.34
228 0.31
229 0.3
230 0.29
231 0.24
232 0.23
233 0.19
234 0.16
235 0.14
236 0.11
237 0.09
238 0.09
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.07
246 0.07
247 0.08
248 0.12
249 0.15
250 0.22
251 0.26
252 0.35
253 0.4
254 0.42
255 0.45
256 0.43
257 0.48
258 0.5
259 0.54