Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TCN3

Protein Details
Accession A0A086TCN3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
237-258RVSPEFRKRKTSSRKCDCPFGFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010061  MeMal-semiAld_DH  
Gene Ontology GO:0004491  F:methylmalonate-semialdehyde dehydrogenase (acylating) activity  
Amino Acid Sequences MSSLGPPGSNPHGLTFSQANLGRNPRFPPPHPTQPGKQSPASHTASPYQSQYAPQQPPQYPQHLFPPQVNGSVPNGTARGPGTHGHNALGIQRQRAAPPRQQMPSQPHTPQQKQKQIPPPVPPAQQHQQVDTAPQQEHSTVEDMDVDGNQEGDSEASGLDSKLLNDPSYVPQQPMGEMMSPPPEGGSYATLEAVQKAVLRYCTSVGYAIVIGRSKKTVPGLKKVLFVCDRSGKPPNRVSPEFRKRKTSSRKCDCPFGFFAIEQRTQWTIRYRPDPAHLRHNHGPSEGPSHHPAARKLDSKMVAAVKQLKENGAGVSETLQILQNENPDCHLLPRDIYNARAAINRNPQKVTSGLAEDRPTIYTKPPQTPEDRIRSDLRRELSKAKEDLQKLEEKRQKDIEALKAQLEEKDKMIEKFEMFIDICNQRVMVQRERLSGSEGNRAAGSNQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.24
4 0.27
5 0.3
6 0.29
7 0.32
8 0.4
9 0.4
10 0.42
11 0.44
12 0.46
13 0.5
14 0.52
15 0.54
16 0.55
17 0.62
18 0.66
19 0.7
20 0.68
21 0.71
22 0.77
23 0.74
24 0.71
25 0.65
26 0.62
27 0.64
28 0.61
29 0.52
30 0.46
31 0.46
32 0.45
33 0.42
34 0.39
35 0.35
36 0.31
37 0.32
38 0.36
39 0.39
40 0.4
41 0.43
42 0.49
43 0.48
44 0.54
45 0.57
46 0.58
47 0.51
48 0.48
49 0.52
50 0.5
51 0.49
52 0.45
53 0.47
54 0.41
55 0.41
56 0.39
57 0.32
58 0.28
59 0.28
60 0.26
61 0.2
62 0.19
63 0.16
64 0.18
65 0.16
66 0.15
67 0.15
68 0.17
69 0.22
70 0.26
71 0.27
72 0.25
73 0.25
74 0.24
75 0.26
76 0.31
77 0.27
78 0.23
79 0.26
80 0.27
81 0.3
82 0.37
83 0.4
84 0.39
85 0.45
86 0.51
87 0.51
88 0.52
89 0.56
90 0.55
91 0.56
92 0.56
93 0.51
94 0.51
95 0.57
96 0.62
97 0.65
98 0.67
99 0.7
100 0.69
101 0.75
102 0.78
103 0.78
104 0.75
105 0.73
106 0.71
107 0.67
108 0.67
109 0.6
110 0.57
111 0.55
112 0.57
113 0.51
114 0.44
115 0.41
116 0.36
117 0.37
118 0.34
119 0.3
120 0.23
121 0.23
122 0.22
123 0.19
124 0.19
125 0.17
126 0.16
127 0.12
128 0.12
129 0.11
130 0.1
131 0.1
132 0.09
133 0.08
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.04
144 0.05
145 0.04
146 0.06
147 0.06
148 0.07
149 0.1
150 0.11
151 0.11
152 0.11
153 0.13
154 0.15
155 0.21
156 0.21
157 0.18
158 0.19
159 0.19
160 0.19
161 0.18
162 0.16
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.11
169 0.1
170 0.08
171 0.08
172 0.08
173 0.09
174 0.07
175 0.08
176 0.08
177 0.08
178 0.08
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.08
185 0.09
186 0.09
187 0.1
188 0.11
189 0.11
190 0.1
191 0.1
192 0.09
193 0.08
194 0.08
195 0.07
196 0.07
197 0.08
198 0.08
199 0.08
200 0.1
201 0.09
202 0.11
203 0.16
204 0.21
205 0.23
206 0.31
207 0.37
208 0.38
209 0.43
210 0.41
211 0.42
212 0.38
213 0.35
214 0.3
215 0.3
216 0.29
217 0.28
218 0.36
219 0.34
220 0.38
221 0.43
222 0.46
223 0.47
224 0.49
225 0.52
226 0.54
227 0.62
228 0.66
229 0.62
230 0.65
231 0.6
232 0.68
233 0.73
234 0.72
235 0.73
236 0.73
237 0.81
238 0.74
239 0.81
240 0.71
241 0.65
242 0.56
243 0.49
244 0.4
245 0.3
246 0.32
247 0.26
248 0.27
249 0.21
250 0.21
251 0.2
252 0.19
253 0.22
254 0.24
255 0.24
256 0.28
257 0.33
258 0.34
259 0.34
260 0.41
261 0.47
262 0.44
263 0.5
264 0.48
265 0.51
266 0.54
267 0.56
268 0.49
269 0.42
270 0.4
271 0.31
272 0.35
273 0.29
274 0.26
275 0.25
276 0.27
277 0.3
278 0.31
279 0.33
280 0.32
281 0.37
282 0.37
283 0.36
284 0.4
285 0.38
286 0.35
287 0.36
288 0.32
289 0.27
290 0.27
291 0.33
292 0.28
293 0.29
294 0.29
295 0.26
296 0.24
297 0.24
298 0.21
299 0.14
300 0.13
301 0.09
302 0.1
303 0.1
304 0.09
305 0.09
306 0.1
307 0.1
308 0.11
309 0.12
310 0.16
311 0.16
312 0.17
313 0.17
314 0.17
315 0.17
316 0.18
317 0.19
318 0.15
319 0.15
320 0.17
321 0.22
322 0.21
323 0.22
324 0.23
325 0.22
326 0.22
327 0.25
328 0.25
329 0.26
330 0.36
331 0.42
332 0.43
333 0.43
334 0.43
335 0.41
336 0.4
337 0.35
338 0.27
339 0.25
340 0.24
341 0.26
342 0.27
343 0.25
344 0.25
345 0.24
346 0.23
347 0.2
348 0.22
349 0.27
350 0.32
351 0.39
352 0.43
353 0.47
354 0.5
355 0.58
356 0.62
357 0.64
358 0.61
359 0.57
360 0.59
361 0.6
362 0.6
363 0.58
364 0.53
365 0.5
366 0.51
367 0.54
368 0.54
369 0.56
370 0.52
371 0.53
372 0.56
373 0.52
374 0.54
375 0.51
376 0.52
377 0.49
378 0.56
379 0.55
380 0.5
381 0.54
382 0.55
383 0.51
384 0.49
385 0.52
386 0.51
387 0.52
388 0.52
389 0.47
390 0.44
391 0.43
392 0.41
393 0.39
394 0.31
395 0.26
396 0.31
397 0.32
398 0.31
399 0.34
400 0.34
401 0.3
402 0.3
403 0.29
404 0.28
405 0.24
406 0.24
407 0.27
408 0.25
409 0.25
410 0.23
411 0.23
412 0.2
413 0.28
414 0.32
415 0.34
416 0.41
417 0.44
418 0.48
419 0.51
420 0.5
421 0.47
422 0.46
423 0.41
424 0.41
425 0.38
426 0.35
427 0.32
428 0.32