Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086T6L6

Protein Details
Accession A0A086T6L6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
203-224KKDREEPSPKKEKKGDSNKKKQBasic
NLS Segment(s)
PositionSequence
204-224KDREEPSPKKEKKGDSNKKKQ
Subcellular Location(s) plas 20, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013248  Psh3/Shr3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08229  SHR3_chaperone  
Amino Acid Sequences MSSMVDWSKTTKSANYYGSTSFATFMIIGRDYLLTCPTHPPATCFLLGLLFAALPYDFPLLWSKEPVSAAYFDQLETHLRFMHQSPPLISRVLNIVLATAFSGFAIKMYRPSEANLLFDGASAILYLIGVAVYTSNTIKGLRAVSEGVWNTDEWKTTREGRVQGEVILGREDSLKVLAASNTILALVLIGVLVLQAGQWYAEKKDREEPSPKKEKKGDSNKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.36
5 0.36
6 0.33
7 0.29
8 0.23
9 0.18
10 0.16
11 0.13
12 0.12
13 0.13
14 0.12
15 0.11
16 0.11
17 0.12
18 0.11
19 0.12
20 0.14
21 0.12
22 0.13
23 0.17
24 0.19
25 0.23
26 0.23
27 0.25
28 0.27
29 0.31
30 0.3
31 0.25
32 0.22
33 0.18
34 0.18
35 0.15
36 0.1
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.05
43 0.06
44 0.06
45 0.07
46 0.11
47 0.14
48 0.15
49 0.17
50 0.16
51 0.18
52 0.19
53 0.19
54 0.16
55 0.15
56 0.15
57 0.15
58 0.15
59 0.12
60 0.12
61 0.12
62 0.13
63 0.12
64 0.13
65 0.11
66 0.11
67 0.12
68 0.13
69 0.19
70 0.19
71 0.2
72 0.21
73 0.23
74 0.24
75 0.23
76 0.22
77 0.15
78 0.15
79 0.14
80 0.12
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.05
87 0.04
88 0.03
89 0.04
90 0.03
91 0.04
92 0.05
93 0.05
94 0.09
95 0.1
96 0.11
97 0.12
98 0.13
99 0.17
100 0.16
101 0.17
102 0.14
103 0.14
104 0.12
105 0.12
106 0.11
107 0.06
108 0.05
109 0.04
110 0.04
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.04
122 0.04
123 0.05
124 0.06
125 0.06
126 0.08
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.15
133 0.15
134 0.14
135 0.14
136 0.13
137 0.15
138 0.15
139 0.17
140 0.13
141 0.14
142 0.16
143 0.2
144 0.25
145 0.27
146 0.31
147 0.32
148 0.35
149 0.34
150 0.32
151 0.3
152 0.26
153 0.22
154 0.18
155 0.15
156 0.11
157 0.11
158 0.1
159 0.08
160 0.08
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.08
169 0.07
170 0.06
171 0.05
172 0.05
173 0.04
174 0.03
175 0.03
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.03
184 0.04
185 0.05
186 0.08
187 0.12
188 0.19
189 0.22
190 0.25
191 0.35
192 0.39
193 0.45
194 0.53
195 0.58
196 0.62
197 0.71
198 0.72
199 0.72
200 0.75
201 0.78
202 0.78
203 0.81
204 0.83