Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086TGJ1

Protein Details
Accession A0A086TGJ1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPISKKDRRNKEHKKADAAGTBasic
NLS Segment(s)
PositionSequence
5-24KKDRRNKEHKKADAAGTRAP
Subcellular Location(s) nucl 15.5, mito_nucl 13.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRRNKEHKKADAAGTRAPVKANGLPVKPPKPTSICQNCRKEIVNTNKIQLEVHAGTHNPKLWPKEKCWPNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.79
4 0.75
5 0.67
6 0.59
7 0.52
8 0.47
9 0.39
10 0.34
11 0.27
12 0.23
13 0.21
14 0.25
15 0.25
16 0.23
17 0.28
18 0.34
19 0.37
20 0.36
21 0.36
22 0.34
23 0.34
24 0.35
25 0.39
26 0.44
27 0.49
28 0.55
29 0.6
30 0.58
31 0.56
32 0.57
33 0.5
34 0.48
35 0.5
36 0.49
37 0.45
38 0.46
39 0.44
40 0.43
41 0.39
42 0.3
43 0.27
44 0.19
45 0.19
46 0.18
47 0.17
48 0.19
49 0.23
50 0.25
51 0.22
52 0.26
53 0.31
54 0.37
55 0.42
56 0.46
57 0.54
58 0.58