Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T5L7

Protein Details
Accession A0A086T5L7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
177-201DKVESKVKGKPGRPKKDTKAPAPVGBasic
NLS Segment(s)
PositionSequence
171-207KVSEAKDKVESKVKGKPGRPKKDTKAPAPVGRTERKT
Subcellular Location(s) cyto 14, cyto_nucl 10.833, mito 7.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
Amino Acid Sequences MATLSSSLNNAAPPAPTVVSAPASNPGATGHGAKVPKPVEVTSVPQTPVQGGTPAGGTPRPELPISEEPPKEPTPEAPVILGPRDPAAGPKEPSPPEPVIETDAPDGAAVMATASHSPTAGPGEKRKAAGEEEEGEKSPLAANGHGQEKSSEDDEDRPDKKAKLTEKIADKVSEAKDKVESKVKGKPGRPKKDTKAPAPVGRTERKTRSQGPAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.14
5 0.15
6 0.17
7 0.16
8 0.16
9 0.18
10 0.19
11 0.18
12 0.17
13 0.15
14 0.15
15 0.16
16 0.16
17 0.13
18 0.17
19 0.18
20 0.18
21 0.25
22 0.24
23 0.25
24 0.25
25 0.24
26 0.24
27 0.25
28 0.3
29 0.28
30 0.31
31 0.3
32 0.28
33 0.28
34 0.24
35 0.23
36 0.19
37 0.15
38 0.11
39 0.11
40 0.1
41 0.1
42 0.1
43 0.1
44 0.11
45 0.12
46 0.13
47 0.15
48 0.15
49 0.15
50 0.21
51 0.27
52 0.29
53 0.34
54 0.33
55 0.32
56 0.37
57 0.37
58 0.32
59 0.26
60 0.23
61 0.23
62 0.24
63 0.23
64 0.19
65 0.19
66 0.18
67 0.18
68 0.17
69 0.1
70 0.09
71 0.09
72 0.08
73 0.1
74 0.12
75 0.15
76 0.16
77 0.18
78 0.24
79 0.25
80 0.26
81 0.28
82 0.26
83 0.23
84 0.23
85 0.21
86 0.19
87 0.18
88 0.17
89 0.13
90 0.12
91 0.11
92 0.09
93 0.08
94 0.04
95 0.04
96 0.03
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.07
107 0.1
108 0.12
109 0.16
110 0.22
111 0.24
112 0.25
113 0.25
114 0.24
115 0.22
116 0.22
117 0.21
118 0.18
119 0.19
120 0.19
121 0.19
122 0.18
123 0.16
124 0.14
125 0.12
126 0.11
127 0.1
128 0.09
129 0.1
130 0.13
131 0.17
132 0.17
133 0.16
134 0.15
135 0.15
136 0.17
137 0.17
138 0.15
139 0.13
140 0.16
141 0.21
142 0.28
143 0.27
144 0.29
145 0.31
146 0.32
147 0.34
148 0.38
149 0.39
150 0.41
151 0.46
152 0.49
153 0.53
154 0.56
155 0.54
156 0.48
157 0.43
158 0.41
159 0.39
160 0.39
161 0.33
162 0.3
163 0.34
164 0.36
165 0.39
166 0.42
167 0.41
168 0.39
169 0.46
170 0.53
171 0.55
172 0.6
173 0.66
174 0.68
175 0.76
176 0.78
177 0.81
178 0.81
179 0.83
180 0.85
181 0.82
182 0.82
183 0.79
184 0.79
185 0.73
186 0.72
187 0.69
188 0.69
189 0.68
190 0.66
191 0.65
192 0.66
193 0.7
194 0.7
195 0.71