Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TB20

Protein Details
Accession A0A086TB20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
201-222ACLSKDRKEREWYRRVDQKRSFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008952  Tetraspanin_EC2_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVNKVLIAAAAADALFLASGILELTFSVIVKNDMVNDPSDGRDAIRHLIYERMPLTAGIVNAGFILAAFLATLPGLLMPTTRGWLKFAGYFVTFCTIFTMCVGVYLWIMTLRIGEDFFEVYMDLDADVQALVQTTFECCGYKSSTSPAFITNPTCPSPAAAALLPGCQAAVSNFANVLLDQIFTAVFGVVGIDVVFILAIACLSKDRKEREWYRRVDQKRSFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.08
18 0.09
19 0.11
20 0.12
21 0.14
22 0.14
23 0.16
24 0.16
25 0.17
26 0.17
27 0.15
28 0.13
29 0.15
30 0.15
31 0.17
32 0.16
33 0.16
34 0.16
35 0.2
36 0.2
37 0.23
38 0.21
39 0.19
40 0.18
41 0.17
42 0.18
43 0.15
44 0.15
45 0.11
46 0.1
47 0.09
48 0.08
49 0.08
50 0.06
51 0.04
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.02
61 0.03
62 0.03
63 0.03
64 0.03
65 0.05
66 0.05
67 0.07
68 0.08
69 0.09
70 0.1
71 0.11
72 0.12
73 0.13
74 0.13
75 0.14
76 0.13
77 0.13
78 0.12
79 0.14
80 0.12
81 0.11
82 0.12
83 0.1
84 0.1
85 0.09
86 0.1
87 0.06
88 0.07
89 0.07
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.05
123 0.05
124 0.06
125 0.06
126 0.08
127 0.11
128 0.12
129 0.13
130 0.17
131 0.2
132 0.21
133 0.22
134 0.22
135 0.21
136 0.22
137 0.24
138 0.22
139 0.22
140 0.22
141 0.22
142 0.2
143 0.19
144 0.18
145 0.16
146 0.15
147 0.12
148 0.12
149 0.11
150 0.12
151 0.11
152 0.09
153 0.08
154 0.06
155 0.06
156 0.05
157 0.09
158 0.1
159 0.1
160 0.1
161 0.1
162 0.11
163 0.1
164 0.11
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.06
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.04
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.07
190 0.09
191 0.16
192 0.23
193 0.29
194 0.36
195 0.47
196 0.57
197 0.64
198 0.72
199 0.74
200 0.76
201 0.8
202 0.81
203 0.81