Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T1H3

Protein Details
Accession A0A086T1H3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRLRLRAVDDVHydrophilic
77-103KYTMFDRKAKRYRKGIHRIPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KAKRYRKGIHRIP
Subcellular Location(s) mito 23, cyto_mito 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSSGLLWKIPWRLSKFQKRRHRLRLRAVDDVVATVDAALAKKGETLEALERWKAEMPTEAEMLPRDKYTMFDRKAKRYRKGIHRIPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.21
5 0.22
6 0.25
7 0.32
8 0.35
9 0.41
10 0.49
11 0.6
12 0.67
13 0.73
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.6
26 0.49
27 0.4
28 0.29
29 0.18
30 0.12
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.1
45 0.12
46 0.11
47 0.12
48 0.12
49 0.14
50 0.13
51 0.11
52 0.13
53 0.14
54 0.16
55 0.17
56 0.16
57 0.15
58 0.16
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.79
77 0.84
78 0.84
79 0.85
80 0.86
81 0.88
82 0.85
83 0.85
84 0.82
85 0.8
86 0.79
87 0.78
88 0.78
89 0.76
90 0.79