Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086TE00

Protein Details
Accession A0A086TE00    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
539-558YLQIWERRREPKDKGKGKASBasic
NLS Segment(s)
PositionSequence
545-558RRREPKDKGKGKAS
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR033809  USP39  
IPR028889  USP_dom  
IPR013083  Znf_RING/FYVE/PHD  
IPR001607  Znf_UBP  
Gene Ontology GO:0005634  C:nucleus  
GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0008270  F:zinc ion binding  
GO:0016579  P:protein deubiquitination  
GO:0000245  P:spliceosomal complex assembly  
Pfam View protein in Pfam  
PF00443  UCH  
PF02148  zf-UBP  
PROSITE View protein in PROSITE  
PS50235  USP_3  
PS50271  ZF_UBP  
CDD cd02669  Peptidase_C19M  
Amino Acid Sequences MGKRQASEALEELGGVASPASKRSRMDEGDSPLENGGQAQTPSEAPNGQSSRDAGRGEDEEDDNNDDVDDDDGLDDDETPATAPIRQSAPTSGYDDLYLDTIDRNVLDFDFEKLCSVSLSNINVYACLVCGKYFQGRGPKSHAYFHSLDEDHHVYINLETQRVYVLPEGYEVKSKALDDIKFVADPRYTRRDAAELDRVPRTSLTLAGKPYTPGFVGMNNIKENDYVNVVVQALSHVSPLRNYFLTTDVSSRPELVKRCGILFRKIWNPRAFKSHVSPHELLQEVSLRSNKRFTLTRQSDPVDFLSWFLNNLHLGLGGSRSKPRSSIVQHTFQGRLKVESQTITARADAEAGDRLRFEEAAEVDVQHARFLFLTLDLPPAPLFQDELERNIIPQVPLTTLLGKYDGRRAQEEHARRKRFRLLHPLPPFLAMHVKRFSQNKFVSERNPTIVTFDARNLDVSPYVEPNPEEWPPGEPIWYDLVANIVHEAVRVRDDVADTSEEKKTWKVQLKDKATGEWVVSQDLFVDKVQNELLYLGESYLQIWERRREPKDKGKGKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.09
3 0.07
4 0.07
5 0.08
6 0.13
7 0.17
8 0.2
9 0.22
10 0.27
11 0.36
12 0.38
13 0.44
14 0.46
15 0.49
16 0.52
17 0.51
18 0.47
19 0.39
20 0.35
21 0.28
22 0.21
23 0.16
24 0.13
25 0.12
26 0.12
27 0.13
28 0.14
29 0.16
30 0.17
31 0.17
32 0.16
33 0.25
34 0.25
35 0.25
36 0.26
37 0.27
38 0.29
39 0.32
40 0.31
41 0.23
42 0.25
43 0.26
44 0.25
45 0.27
46 0.24
47 0.21
48 0.23
49 0.25
50 0.21
51 0.19
52 0.17
53 0.14
54 0.13
55 0.12
56 0.09
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.1
70 0.1
71 0.13
72 0.15
73 0.16
74 0.18
75 0.2
76 0.22
77 0.23
78 0.26
79 0.23
80 0.22
81 0.21
82 0.2
83 0.17
84 0.15
85 0.12
86 0.09
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.1
95 0.1
96 0.13
97 0.14
98 0.14
99 0.14
100 0.14
101 0.14
102 0.12
103 0.12
104 0.12
105 0.14
106 0.16
107 0.16
108 0.18
109 0.18
110 0.17
111 0.17
112 0.14
113 0.1
114 0.09
115 0.09
116 0.07
117 0.08
118 0.11
119 0.15
120 0.17
121 0.21
122 0.3
123 0.32
124 0.36
125 0.42
126 0.47
127 0.45
128 0.49
129 0.47
130 0.43
131 0.42
132 0.4
133 0.4
134 0.33
135 0.31
136 0.3
137 0.3
138 0.24
139 0.23
140 0.21
141 0.15
142 0.14
143 0.2
144 0.16
145 0.14
146 0.14
147 0.13
148 0.14
149 0.13
150 0.14
151 0.1
152 0.1
153 0.09
154 0.12
155 0.14
156 0.14
157 0.18
158 0.17
159 0.16
160 0.16
161 0.16
162 0.18
163 0.21
164 0.21
165 0.19
166 0.21
167 0.22
168 0.22
169 0.22
170 0.21
171 0.18
172 0.19
173 0.22
174 0.27
175 0.27
176 0.27
177 0.28
178 0.29
179 0.29
180 0.33
181 0.36
182 0.32
183 0.34
184 0.35
185 0.33
186 0.31
187 0.28
188 0.24
189 0.16
190 0.18
191 0.18
192 0.19
193 0.21
194 0.21
195 0.21
196 0.2
197 0.2
198 0.17
199 0.13
200 0.11
201 0.1
202 0.1
203 0.13
204 0.15
205 0.17
206 0.17
207 0.17
208 0.16
209 0.16
210 0.16
211 0.13
212 0.12
213 0.1
214 0.09
215 0.09
216 0.09
217 0.08
218 0.07
219 0.07
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.08
226 0.1
227 0.12
228 0.11
229 0.12
230 0.12
231 0.13
232 0.15
233 0.14
234 0.15
235 0.14
236 0.16
237 0.16
238 0.16
239 0.16
240 0.18
241 0.19
242 0.2
243 0.22
244 0.21
245 0.22
246 0.27
247 0.28
248 0.29
249 0.29
250 0.3
251 0.36
252 0.41
253 0.46
254 0.47
255 0.48
256 0.45
257 0.49
258 0.47
259 0.41
260 0.41
261 0.42
262 0.39
263 0.42
264 0.41
265 0.35
266 0.36
267 0.34
268 0.29
269 0.22
270 0.21
271 0.14
272 0.15
273 0.18
274 0.15
275 0.16
276 0.18
277 0.18
278 0.18
279 0.21
280 0.23
281 0.31
282 0.35
283 0.38
284 0.39
285 0.41
286 0.38
287 0.37
288 0.34
289 0.24
290 0.19
291 0.16
292 0.13
293 0.11
294 0.11
295 0.09
296 0.09
297 0.08
298 0.08
299 0.07
300 0.06
301 0.06
302 0.06
303 0.08
304 0.08
305 0.09
306 0.13
307 0.14
308 0.15
309 0.16
310 0.17
311 0.22
312 0.26
313 0.35
314 0.37
315 0.41
316 0.43
317 0.44
318 0.46
319 0.41
320 0.41
321 0.31
322 0.29
323 0.25
324 0.25
325 0.24
326 0.21
327 0.21
328 0.18
329 0.19
330 0.17
331 0.15
332 0.14
333 0.12
334 0.12
335 0.1
336 0.09
337 0.11
338 0.11
339 0.11
340 0.1
341 0.11
342 0.11
343 0.11
344 0.1
345 0.1
346 0.09
347 0.11
348 0.11
349 0.1
350 0.11
351 0.13
352 0.13
353 0.1
354 0.09
355 0.08
356 0.08
357 0.09
358 0.08
359 0.07
360 0.08
361 0.08
362 0.1
363 0.1
364 0.1
365 0.1
366 0.09
367 0.1
368 0.09
369 0.09
370 0.07
371 0.14
372 0.14
373 0.16
374 0.19
375 0.18
376 0.18
377 0.19
378 0.2
379 0.13
380 0.14
381 0.13
382 0.11
383 0.12
384 0.13
385 0.14
386 0.12
387 0.13
388 0.14
389 0.14
390 0.15
391 0.22
392 0.24
393 0.24
394 0.27
395 0.29
396 0.33
397 0.41
398 0.49
399 0.52
400 0.59
401 0.65
402 0.64
403 0.67
404 0.7
405 0.69
406 0.68
407 0.69
408 0.66
409 0.67
410 0.72
411 0.7
412 0.61
413 0.56
414 0.47
415 0.37
416 0.4
417 0.31
418 0.3
419 0.29
420 0.3
421 0.33
422 0.39
423 0.4
424 0.41
425 0.43
426 0.43
427 0.45
428 0.48
429 0.49
430 0.5
431 0.51
432 0.45
433 0.43
434 0.38
435 0.35
436 0.34
437 0.3
438 0.24
439 0.23
440 0.22
441 0.2
442 0.21
443 0.19
444 0.18
445 0.17
446 0.17
447 0.16
448 0.17
449 0.18
450 0.19
451 0.18
452 0.18
453 0.22
454 0.21
455 0.21
456 0.19
457 0.2
458 0.22
459 0.22
460 0.22
461 0.17
462 0.18
463 0.2
464 0.2
465 0.17
466 0.13
467 0.15
468 0.13
469 0.13
470 0.11
471 0.08
472 0.08
473 0.08
474 0.09
475 0.08
476 0.1
477 0.1
478 0.11
479 0.12
480 0.14
481 0.15
482 0.16
483 0.18
484 0.18
485 0.21
486 0.24
487 0.23
488 0.23
489 0.25
490 0.29
491 0.35
492 0.43
493 0.47
494 0.54
495 0.64
496 0.7
497 0.75
498 0.71
499 0.64
500 0.58
501 0.53
502 0.45
503 0.39
504 0.32
505 0.27
506 0.25
507 0.21
508 0.19
509 0.18
510 0.18
511 0.13
512 0.17
513 0.14
514 0.16
515 0.18
516 0.16
517 0.16
518 0.15
519 0.15
520 0.11
521 0.11
522 0.09
523 0.1
524 0.09
525 0.09
526 0.13
527 0.15
528 0.18
529 0.24
530 0.31
531 0.38
532 0.48
533 0.54
534 0.59
535 0.66
536 0.73
537 0.78
538 0.8
539 0.8