Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T826

Protein Details
Accession A0A086T826    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23VGGIHKKRRNLWQSDRKTSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MVLVGGIHKKRRNLWQSDRKTSSACVGAKTHRGQMEQLEVAHRGPMVVVLLRRNLPKRSIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.76
4 0.81
5 0.8
6 0.71
7 0.64
8 0.55
9 0.47
10 0.43
11 0.34
12 0.27
13 0.25
14 0.25
15 0.3
16 0.3
17 0.3
18 0.25
19 0.25
20 0.24
21 0.23
22 0.25
23 0.2
24 0.19
25 0.17
26 0.16
27 0.15
28 0.15
29 0.13
30 0.08
31 0.07
32 0.07
33 0.07
34 0.09
35 0.11
36 0.13
37 0.16
38 0.2
39 0.27
40 0.32
41 0.34