Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SW51

Protein Details
Accession A0A086SW51    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPPWPTQHHCPKCQKKSKSMSRVGHCKKHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.333, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPWPTQHHCPKCQKKSKSMSRVGHCKKHQWTCADNHTEWVQLKTEPCERCEKEYVEGENCHQCDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.87
4 0.88
5 0.87
6 0.86
7 0.84
8 0.81
9 0.85
10 0.82
11 0.81
12 0.73
13 0.71
14 0.69
15 0.68
16 0.65
17 0.59
18 0.56
19 0.51
20 0.56
21 0.52
22 0.44
23 0.39
24 0.34
25 0.32
26 0.29
27 0.25
28 0.19
29 0.15
30 0.17
31 0.19
32 0.25
33 0.24
34 0.26
35 0.34
36 0.36
37 0.4
38 0.44
39 0.42
40 0.41
41 0.45
42 0.47
43 0.43
44 0.42
45 0.41
46 0.43
47 0.41