Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SXK8

Protein Details
Accession A0A086SXK8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
266-295LEERERRLREERERQRRERERQQEEWRKASBasic
NLS Segment(s)
PositionSequence
264-287RELEERERRLREERERQRRERERQ
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019258  Mediator_Med4  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10018  Med4  
Amino Acid Sequences MDTYIDGRFERLEKALANLIDSVNKYHPSTVHAKELEAADEELTKGLEQIQAHQVNYLRVQQLRKSSAALDTQIKDTLTSLASTRRDITNTRTTTFPAGPNYPVAYDELLSYARRISKTTMPPAGTLKPPSGTSATTPEIQTPADMATPSASAAPTPSQPLSPAVNGASTPLPTQQAVVGATQQSAVTTNTSLPDVVSQYLNPLSGQLFFPWPLEDKIRNGALASNQILAEKGIDPRGYDPAEEEERQRKAEEEQKEREEQEKRELEERERRLREERERQRRERERQQEEWRKASMSGPSPERAPSRSNTGEKKQFQFRSLDDDLDEDDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.25
4 0.25
5 0.23
6 0.22
7 0.23
8 0.23
9 0.24
10 0.22
11 0.25
12 0.24
13 0.25
14 0.26
15 0.27
16 0.34
17 0.34
18 0.39
19 0.37
20 0.36
21 0.37
22 0.37
23 0.33
24 0.27
25 0.24
26 0.15
27 0.15
28 0.15
29 0.12
30 0.11
31 0.09
32 0.08
33 0.09
34 0.11
35 0.11
36 0.15
37 0.24
38 0.26
39 0.26
40 0.29
41 0.3
42 0.29
43 0.31
44 0.32
45 0.27
46 0.28
47 0.31
48 0.33
49 0.39
50 0.41
51 0.39
52 0.36
53 0.34
54 0.34
55 0.33
56 0.32
57 0.29
58 0.27
59 0.28
60 0.28
61 0.26
62 0.22
63 0.2
64 0.18
65 0.13
66 0.12
67 0.12
68 0.16
69 0.18
70 0.19
71 0.21
72 0.21
73 0.23
74 0.25
75 0.3
76 0.33
77 0.35
78 0.35
79 0.33
80 0.33
81 0.35
82 0.35
83 0.32
84 0.27
85 0.26
86 0.25
87 0.26
88 0.25
89 0.21
90 0.19
91 0.17
92 0.13
93 0.11
94 0.1
95 0.09
96 0.1
97 0.1
98 0.09
99 0.1
100 0.13
101 0.14
102 0.15
103 0.17
104 0.24
105 0.31
106 0.37
107 0.4
108 0.38
109 0.39
110 0.41
111 0.4
112 0.35
113 0.3
114 0.25
115 0.21
116 0.2
117 0.21
118 0.19
119 0.17
120 0.15
121 0.18
122 0.19
123 0.19
124 0.19
125 0.17
126 0.17
127 0.16
128 0.14
129 0.1
130 0.09
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.05
140 0.06
141 0.07
142 0.07
143 0.09
144 0.09
145 0.09
146 0.1
147 0.12
148 0.13
149 0.12
150 0.12
151 0.1
152 0.1
153 0.09
154 0.1
155 0.08
156 0.07
157 0.07
158 0.08
159 0.08
160 0.08
161 0.09
162 0.07
163 0.08
164 0.09
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.06
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.08
178 0.08
179 0.08
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.09
187 0.1
188 0.1
189 0.09
190 0.08
191 0.08
192 0.09
193 0.09
194 0.08
195 0.09
196 0.1
197 0.1
198 0.11
199 0.12
200 0.13
201 0.16
202 0.17
203 0.18
204 0.22
205 0.22
206 0.21
207 0.19
208 0.19
209 0.17
210 0.18
211 0.17
212 0.14
213 0.14
214 0.14
215 0.14
216 0.12
217 0.12
218 0.09
219 0.1
220 0.12
221 0.12
222 0.13
223 0.14
224 0.19
225 0.18
226 0.16
227 0.17
228 0.19
229 0.24
230 0.24
231 0.27
232 0.29
233 0.31
234 0.32
235 0.31
236 0.27
237 0.28
238 0.35
239 0.39
240 0.41
241 0.46
242 0.49
243 0.53
244 0.53
245 0.55
246 0.54
247 0.48
248 0.49
249 0.48
250 0.46
251 0.48
252 0.5
253 0.51
254 0.54
255 0.59
256 0.59
257 0.57
258 0.58
259 0.59
260 0.64
261 0.67
262 0.68
263 0.72
264 0.73
265 0.79
266 0.83
267 0.87
268 0.88
269 0.88
270 0.88
271 0.87
272 0.84
273 0.84
274 0.88
275 0.88
276 0.84
277 0.79
278 0.71
279 0.61
280 0.54
281 0.48
282 0.44
283 0.4
284 0.4
285 0.39
286 0.38
287 0.38
288 0.42
289 0.42
290 0.38
291 0.35
292 0.32
293 0.37
294 0.43
295 0.49
296 0.53
297 0.59
298 0.66
299 0.69
300 0.73
301 0.74
302 0.71
303 0.67
304 0.64
305 0.56
306 0.55
307 0.51
308 0.45
309 0.36
310 0.33
311 0.31