Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EB14

Protein Details
Accession A7EB14   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-141EQTQQTHQTKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRNKETNTLKIIRBasic
NLS Segment(s)
PositionSequence
39-132KKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRNK
Subcellular Location(s) nucl 21, cyto_nucl 14, mito 3, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_02500  -  
Amino Acid Sequences MLFVPNPNPKSSSNPNPTPNTIPIPHSTQEQTQQTHQTKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRNKETNTLKIIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.65
4 0.67
5 0.64
6 0.6
7 0.55
8 0.48
9 0.43
10 0.39
11 0.39
12 0.36
13 0.34
14 0.32
15 0.29
16 0.35
17 0.37
18 0.36
19 0.35
20 0.44
21 0.46
22 0.52
23 0.54
24 0.57
25 0.61
26 0.68
27 0.73
28 0.74
29 0.8
30 0.82
31 0.87
32 0.89
33 0.9
34 0.9
35 0.87
36 0.87
37 0.87
38 0.85
39 0.85
40 0.85
41 0.85
42 0.85
43 0.85
44 0.85
45 0.85
46 0.85
47 0.85
48 0.85
49 0.85
50 0.85
51 0.85
52 0.85
53 0.85
54 0.85
55 0.85
56 0.85
57 0.85
58 0.85
59 0.85
60 0.85
61 0.85
62 0.85
63 0.85
64 0.85
65 0.85
66 0.85
67 0.85
68 0.85
69 0.85
70 0.85
71 0.85
72 0.85
73 0.85
74 0.85
75 0.85
76 0.85
77 0.85
78 0.85
79 0.85
80 0.85
81 0.85
82 0.85
83 0.85
84 0.85
85 0.85
86 0.85
87 0.85
88 0.85
89 0.85
90 0.85
91 0.85
92 0.85
93 0.85
94 0.85
95 0.85
96 0.85
97 0.85
98 0.85
99 0.85
100 0.85
101 0.85
102 0.85
103 0.85
104 0.85
105 0.85
106 0.85
107 0.85
108 0.85
109 0.85
110 0.85
111 0.85
112 0.85
113 0.85
114 0.86
115 0.9
116 0.9
117 0.89
118 0.87
119 0.87
120 0.86
121 0.85