Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086T253

Protein Details
Accession A0A086T253    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78GDAAWRHRRQRTRPLAPPLWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MVQFSPSVCWCLLGIATLAGAKPPRVLPAGEQLGPPEQLNALTKISDTNDESMSGEIVGDAAWRHRRQRTRPLAPPLWISGEEVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.08
4 0.07
5 0.07
6 0.08
7 0.09
8 0.08
9 0.1
10 0.1
11 0.12
12 0.14
13 0.14
14 0.14
15 0.22
16 0.25
17 0.24
18 0.23
19 0.22
20 0.22
21 0.22
22 0.2
23 0.12
24 0.08
25 0.09
26 0.1
27 0.1
28 0.09
29 0.08
30 0.09
31 0.09
32 0.1
33 0.11
34 0.11
35 0.11
36 0.11
37 0.12
38 0.12
39 0.11
40 0.11
41 0.08
42 0.07
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.08
49 0.15
50 0.18
51 0.24
52 0.32
53 0.42
54 0.49
55 0.6
56 0.67
57 0.7
58 0.77
59 0.81
60 0.78
61 0.73
62 0.68
63 0.6
64 0.54
65 0.44
66 0.37