Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SVL1

Protein Details
Accession A0A086SVL1   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
257-299NSSFVQHCNKHRKPYRCTKEHCPNPPKKRRFARRDGLERHLNTHydrophilic
NLS Segment(s)
PositionSequence
283-287KKRRF
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSLPSPMEIFESSLPPSSPTATTASLLEVLVREKLETAQNMVTASQSSSPFSYNRHSDTNSLLNEMGDYMNRLALVSAKLTEGLVSGEHINHAAMEVHMKAQRDTHLADLSSVAALDVQLDRLRKMRDLTYKWSRDVEAIWRPETGVRSEASPSQPSISPFVEIKPLSMQHATLSLDDSRSHTRRSLPGGSHKDQRSPKDHGSGSEASDDGDEELFQSIDMAALGNRGKGSYYCPKGIACTKGGVDKFGNLIAFERNSSFVQHCNKHRKPYRCTKEHCPNPPKKRRFARRDGLERHLNTVSHAPPHVDVPDSSAVKVESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.2
4 0.2
5 0.19
6 0.19
7 0.21
8 0.2
9 0.21
10 0.2
11 0.2
12 0.18
13 0.17
14 0.15
15 0.12
16 0.12
17 0.13
18 0.13
19 0.11
20 0.11
21 0.14
22 0.18
23 0.18
24 0.21
25 0.2
26 0.21
27 0.21
28 0.21
29 0.19
30 0.15
31 0.15
32 0.15
33 0.14
34 0.15
35 0.16
36 0.18
37 0.18
38 0.21
39 0.27
40 0.28
41 0.31
42 0.34
43 0.35
44 0.35
45 0.39
46 0.42
47 0.36
48 0.33
49 0.29
50 0.24
51 0.22
52 0.21
53 0.16
54 0.1
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.08
61 0.09
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.07
70 0.07
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.07
78 0.06
79 0.07
80 0.06
81 0.05
82 0.07
83 0.07
84 0.1
85 0.12
86 0.13
87 0.13
88 0.15
89 0.17
90 0.18
91 0.19
92 0.19
93 0.19
94 0.18
95 0.18
96 0.16
97 0.14
98 0.11
99 0.1
100 0.07
101 0.04
102 0.04
103 0.05
104 0.04
105 0.05
106 0.07
107 0.08
108 0.09
109 0.13
110 0.15
111 0.16
112 0.18
113 0.23
114 0.3
115 0.34
116 0.41
117 0.47
118 0.49
119 0.49
120 0.48
121 0.42
122 0.34
123 0.32
124 0.3
125 0.26
126 0.26
127 0.25
128 0.23
129 0.23
130 0.24
131 0.24
132 0.19
133 0.13
134 0.11
135 0.11
136 0.13
137 0.15
138 0.16
139 0.15
140 0.14
141 0.14
142 0.16
143 0.16
144 0.18
145 0.16
146 0.15
147 0.14
148 0.14
149 0.17
150 0.15
151 0.15
152 0.13
153 0.14
154 0.14
155 0.14
156 0.14
157 0.09
158 0.12
159 0.12
160 0.1
161 0.11
162 0.1
163 0.11
164 0.11
165 0.14
166 0.18
167 0.19
168 0.2
169 0.21
170 0.24
171 0.27
172 0.32
173 0.35
174 0.31
175 0.4
176 0.46
177 0.47
178 0.52
179 0.5
180 0.52
181 0.51
182 0.54
183 0.49
184 0.48
185 0.49
186 0.48
187 0.48
188 0.41
189 0.42
190 0.38
191 0.33
192 0.28
193 0.24
194 0.17
195 0.16
196 0.14
197 0.09
198 0.07
199 0.06
200 0.05
201 0.06
202 0.05
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.04
209 0.03
210 0.06
211 0.07
212 0.07
213 0.07
214 0.07
215 0.08
216 0.09
217 0.15
218 0.22
219 0.26
220 0.27
221 0.29
222 0.29
223 0.33
224 0.38
225 0.36
226 0.28
227 0.26
228 0.25
229 0.3
230 0.3
231 0.29
232 0.25
233 0.22
234 0.21
235 0.2
236 0.19
237 0.13
238 0.15
239 0.14
240 0.14
241 0.14
242 0.14
243 0.15
244 0.15
245 0.18
246 0.18
247 0.22
248 0.29
249 0.36
250 0.44
251 0.53
252 0.58
253 0.67
254 0.75
255 0.78
256 0.79
257 0.83
258 0.85
259 0.83
260 0.84
261 0.84
262 0.86
263 0.87
264 0.88
265 0.87
266 0.87
267 0.88
268 0.92
269 0.9
270 0.89
271 0.9
272 0.91
273 0.9
274 0.9
275 0.89
276 0.89
277 0.91
278 0.87
279 0.84
280 0.83
281 0.74
282 0.69
283 0.61
284 0.5
285 0.43
286 0.42
287 0.37
288 0.31
289 0.31
290 0.28
291 0.26
292 0.29
293 0.28
294 0.23
295 0.21
296 0.22
297 0.29
298 0.28
299 0.27
300 0.26