Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SYL0

Protein Details
Accession A0A086SYL0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-34MLCSRVQTILRQRRRKQAHKPLPEISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MQIKTNVRMLCSRVQTILRQRRRKQAHKPLPEISAPFDFKREPVLLPGISQEELSILREKAAASRIGVAETMPSSPMLSRNSSRSPIVTGLPSAKASTSSSPCFAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.48
4 0.55
5 0.58
6 0.63
7 0.68
8 0.75
9 0.82
10 0.84
11 0.85
12 0.86
13 0.86
14 0.85
15 0.85
16 0.79
17 0.72
18 0.64
19 0.54
20 0.46
21 0.41
22 0.34
23 0.28
24 0.26
25 0.22
26 0.2
27 0.23
28 0.2
29 0.15
30 0.15
31 0.18
32 0.16
33 0.15
34 0.16
35 0.13
36 0.12
37 0.12
38 0.09
39 0.07
40 0.07
41 0.08
42 0.09
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.12
49 0.11
50 0.1
51 0.12
52 0.12
53 0.12
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.06
60 0.06
61 0.06
62 0.07
63 0.11
64 0.13
65 0.17
66 0.2
67 0.25
68 0.29
69 0.32
70 0.33
71 0.3
72 0.3
73 0.28
74 0.28
75 0.24
76 0.22
77 0.22
78 0.23
79 0.22
80 0.2
81 0.18
82 0.17
83 0.19
84 0.24
85 0.27
86 0.28