Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086THM9

Protein Details
Accession A0A086THM9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 11, mito 5, E.R. 4, cyto_mito 4, cyto 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVVASTVFLYYTIWTLLMPFVDDDHPLQNFFPPRVWAIRIPVILILLGSAVVGSFLGVVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.08
6 0.08
7 0.07
8 0.08
9 0.08
10 0.1
11 0.1
12 0.12
13 0.12
14 0.12
15 0.12
16 0.15
17 0.16
18 0.16
19 0.16
20 0.14
21 0.16
22 0.17
23 0.19
24 0.17
25 0.18
26 0.21
27 0.19
28 0.18
29 0.16
30 0.14
31 0.12
32 0.1
33 0.07
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.05
48 0.09
49 0.16
50 0.19
51 0.23
52 0.3
53 0.35
54 0.43
55 0.49
56 0.57
57 0.6
58 0.65
59 0.72
60 0.75