Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EI96

Protein Details
Accession A7EI96    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
15-45KSQTPKVEPQEKKKRPKGRAAKREKFTRRFVBasic
NLS Segment(s)
PositionSequence
13-43KVKSQTPKVEPQEKKKRPKGRAAKREKFTRR
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ssl:SS1G_05038  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKRPKGRAAKREKFTRRFVNVTMTGGKRKMNPNPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.65
9 0.64
10 0.67
11 0.71
12 0.74
13 0.8
14 0.8
15 0.82
16 0.78
17 0.82
18 0.82
19 0.82
20 0.84
21 0.85
22 0.84
23 0.82
24 0.86
25 0.85
26 0.81
27 0.78
28 0.77
29 0.71
30 0.66
31 0.61
32 0.58
33 0.51
34 0.47
35 0.46
36 0.39
37 0.38
38 0.36
39 0.37
40 0.35
41 0.42
42 0.47