Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SVV9

Protein Details
Accession A0A086SVV9    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29TGSSETPQPPRKPIKQKMAASLKSFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 7.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009737  Aim32/Apd1-like  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF06999  Suc_Fer-like  
Amino Acid Sequences MTGTTGSSETPQPPRKPIKQKMAASLKSFGSWVIGGAGGNGNGAGHPAPMGELFAKTDPATDGEECLHDCETCAVRYPRGFKIEEEDALYGEVKAWSTHLIVGTGKADWVRDVADEKGSVMEAVDKAGPPSNGKMKLSASNMPTPHDTSDYSEPATVLLLPAFTLIDNVRPANVPTLITDIVSHAPTTATPLHPTSSIPASVGDLSTRRCPHNAVILMCSQGTRDARCGQSAPLLRRELERHLRPLGLYRDLHDERPGGVGIYFISHVGGHKYSANVMVYRRPNAFGQDDVAGGGGGQEEGEKEEEEEGGGEKGGRSGDVGAAQCIWLARIKPEDCENLVRYTVLKGKVVKPESQLRGGFDRAKGLMSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.76
4 0.8
5 0.81
6 0.82
7 0.84
8 0.85
9 0.85
10 0.81
11 0.74
12 0.68
13 0.58
14 0.49
15 0.43
16 0.32
17 0.24
18 0.18
19 0.14
20 0.11
21 0.1
22 0.09
23 0.1
24 0.11
25 0.08
26 0.08
27 0.08
28 0.07
29 0.06
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.08
38 0.08
39 0.08
40 0.11
41 0.11
42 0.13
43 0.12
44 0.14
45 0.13
46 0.14
47 0.17
48 0.15
49 0.16
50 0.15
51 0.17
52 0.16
53 0.17
54 0.16
55 0.12
56 0.12
57 0.15
58 0.16
59 0.15
60 0.22
61 0.22
62 0.26
63 0.3
64 0.35
65 0.36
66 0.39
67 0.4
68 0.33
69 0.38
70 0.38
71 0.35
72 0.32
73 0.27
74 0.22
75 0.21
76 0.21
77 0.14
78 0.11
79 0.1
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.11
89 0.12
90 0.12
91 0.11
92 0.11
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.1
100 0.1
101 0.11
102 0.11
103 0.11
104 0.11
105 0.1
106 0.09
107 0.07
108 0.08
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.12
115 0.12
116 0.11
117 0.15
118 0.21
119 0.24
120 0.24
121 0.26
122 0.26
123 0.3
124 0.32
125 0.34
126 0.3
127 0.32
128 0.32
129 0.32
130 0.31
131 0.27
132 0.25
133 0.22
134 0.2
135 0.18
136 0.22
137 0.21
138 0.2
139 0.18
140 0.17
141 0.15
142 0.14
143 0.1
144 0.06
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.05
152 0.04
153 0.06
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.1
160 0.1
161 0.09
162 0.08
163 0.11
164 0.11
165 0.1
166 0.1
167 0.09
168 0.1
169 0.1
170 0.09
171 0.06
172 0.06
173 0.06
174 0.09
175 0.1
176 0.09
177 0.11
178 0.12
179 0.12
180 0.13
181 0.13
182 0.12
183 0.12
184 0.11
185 0.1
186 0.09
187 0.09
188 0.09
189 0.09
190 0.08
191 0.08
192 0.1
193 0.15
194 0.17
195 0.17
196 0.18
197 0.2
198 0.21
199 0.28
200 0.3
201 0.26
202 0.25
203 0.25
204 0.25
205 0.23
206 0.21
207 0.13
208 0.13
209 0.13
210 0.12
211 0.15
212 0.18
213 0.19
214 0.21
215 0.21
216 0.18
217 0.23
218 0.27
219 0.27
220 0.29
221 0.3
222 0.29
223 0.31
224 0.33
225 0.35
226 0.39
227 0.39
228 0.38
229 0.38
230 0.38
231 0.35
232 0.39
233 0.35
234 0.32
235 0.28
236 0.26
237 0.33
238 0.34
239 0.34
240 0.3
241 0.26
242 0.21
243 0.23
244 0.21
245 0.12
246 0.11
247 0.1
248 0.08
249 0.08
250 0.08
251 0.06
252 0.06
253 0.06
254 0.07
255 0.09
256 0.1
257 0.1
258 0.11
259 0.12
260 0.12
261 0.15
262 0.16
263 0.16
264 0.17
265 0.23
266 0.26
267 0.29
268 0.3
269 0.29
270 0.29
271 0.31
272 0.32
273 0.25
274 0.24
275 0.21
276 0.19
277 0.17
278 0.16
279 0.11
280 0.08
281 0.07
282 0.05
283 0.04
284 0.03
285 0.04
286 0.04
287 0.06
288 0.07
289 0.07
290 0.08
291 0.09
292 0.09
293 0.09
294 0.09
295 0.09
296 0.08
297 0.08
298 0.08
299 0.07
300 0.09
301 0.09
302 0.08
303 0.08
304 0.09
305 0.1
306 0.14
307 0.15
308 0.14
309 0.14
310 0.14
311 0.14
312 0.13
313 0.12
314 0.11
315 0.11
316 0.15
317 0.23
318 0.24
319 0.27
320 0.32
321 0.36
322 0.37
323 0.42
324 0.41
325 0.36
326 0.36
327 0.33
328 0.28
329 0.28
330 0.31
331 0.27
332 0.3
333 0.32
334 0.38
335 0.47
336 0.5
337 0.5
338 0.5
339 0.57
340 0.57
341 0.59
342 0.56
343 0.5
344 0.51
345 0.52
346 0.51
347 0.42
348 0.42
349 0.35