Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TCM3

Protein Details
Accession A0A086TCM3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-98LLVWFLVRLRRKRKQRQTSHIADKRSHydrophilic
NLS Segment(s)
PositionSequence
83-86RKRK
Subcellular Location(s) cyto 11.5, cyto_nucl 8.5, nucl 4.5, plas 4, mito 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPFIPEVDDAFGAGTIPTQTIAYDTPTLALRNEETNEATTPSYNKDDVWYRLGGSIAGLVVGSIAGAVLIGLLVWFLVRLRRKRKQRQTSHIADKRSSTPSSVEEAGTTAPHPPPPPTAEVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.09
10 0.11
11 0.12
12 0.11
13 0.12
14 0.14
15 0.15
16 0.13
17 0.14
18 0.12
19 0.14
20 0.16
21 0.16
22 0.16
23 0.17
24 0.17
25 0.17
26 0.16
27 0.14
28 0.14
29 0.15
30 0.16
31 0.15
32 0.14
33 0.16
34 0.2
35 0.22
36 0.24
37 0.21
38 0.19
39 0.19
40 0.19
41 0.15
42 0.11
43 0.08
44 0.05
45 0.05
46 0.04
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.01
53 0.01
54 0.01
55 0.01
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.02
64 0.02
65 0.08
66 0.14
67 0.22
68 0.32
69 0.41
70 0.53
71 0.64
72 0.75
73 0.81
74 0.86
75 0.88
76 0.88
77 0.89
78 0.89
79 0.84
80 0.77
81 0.67
82 0.6
83 0.55
84 0.5
85 0.41
86 0.32
87 0.29
88 0.27
89 0.3
90 0.28
91 0.24
92 0.19
93 0.19
94 0.18
95 0.16
96 0.14
97 0.13
98 0.13
99 0.17
100 0.18
101 0.2
102 0.24
103 0.27
104 0.31