Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A086T1I4

Protein Details
Accession A0A086T1I4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-63KQTTSQRRPTRKGEHPCRRPPARPBasic
NLS Segment(s)
PositionSequence
47-52RPTRKG
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSSFHNVIPTKMRATAVQNWDGRATMRLEPRQSRDGRHGKQTTSQRRPTRKGEHPCRRPPARPGMASAAVHADLRSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.37
4 0.41
5 0.4
6 0.38
7 0.38
8 0.35
9 0.3
10 0.24
11 0.21
12 0.18
13 0.24
14 0.27
15 0.31
16 0.35
17 0.39
18 0.45
19 0.44
20 0.42
21 0.45
22 0.5
23 0.48
24 0.53
25 0.5
26 0.44
27 0.49
28 0.56
29 0.57
30 0.56
31 0.63
32 0.62
33 0.68
34 0.73
35 0.75
36 0.74
37 0.73
38 0.76
39 0.78
40 0.8
41 0.82
42 0.85
43 0.86
44 0.84
45 0.79
46 0.76
47 0.75
48 0.72
49 0.64
50 0.59
51 0.56
52 0.55
53 0.49
54 0.42
55 0.34
56 0.27
57 0.26
58 0.21