Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EN79

Protein Details
Accession A7EN79   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKTKPGNKKDYKREKAALNRDIEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_mito 10, mito 4.5, nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0051301  P:cell division  
GO:0045842  P:positive regulation of mitotic metaphase/anaphase transition  
GO:0016567  P:protein ubiquitination  
KEGG ssl:SS1G_06778  -  
Pfam View protein in Pfam  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MAKTKPGNKKDYKREKAALNRDIEGAVPFAKKALELVDVQAIEALPVLNLLGEVHVELGDVDSARQYFMQAAGIDEDGEVSEELGGGAEKFLWLAQLSEDGGEDSVGWYEKGAISLKAQIGALLEKMEKNKLDDAGLAILEEKRRKLAVALCGVVEVYMTDLSWEEDAEQKCEALVTEATMVAPNYPEPWQTLANVRISQTRMGDAQAALKRSLDLWKDLPPENDVVPDFPTKVSLARLLMEADMDIEAIEVLERLVGEDDTSVEVWYLGGWGLYIMGEKQKNGENAQQENNVDGESWKVSWISSQQWLNHCLRLFEQQDYEDERLGAHAKELISILNTELGEEAVNAEAEVEGDGDGEGWEYSDDDEEMVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.84
5 0.81
6 0.73
7 0.66
8 0.58
9 0.51
10 0.42
11 0.33
12 0.24
13 0.19
14 0.15
15 0.13
16 0.13
17 0.13
18 0.12
19 0.12
20 0.13
21 0.13
22 0.13
23 0.15
24 0.19
25 0.19
26 0.18
27 0.18
28 0.16
29 0.13
30 0.12
31 0.1
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.12
57 0.11
58 0.12
59 0.12
60 0.12
61 0.12
62 0.11
63 0.1
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.04
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.08
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.07
98 0.09
99 0.1
100 0.1
101 0.1
102 0.15
103 0.15
104 0.15
105 0.15
106 0.13
107 0.13
108 0.12
109 0.12
110 0.09
111 0.09
112 0.1
113 0.11
114 0.14
115 0.14
116 0.16
117 0.18
118 0.18
119 0.17
120 0.16
121 0.16
122 0.14
123 0.13
124 0.1
125 0.09
126 0.09
127 0.12
128 0.13
129 0.13
130 0.13
131 0.13
132 0.14
133 0.16
134 0.19
135 0.22
136 0.24
137 0.25
138 0.23
139 0.23
140 0.22
141 0.19
142 0.14
143 0.07
144 0.04
145 0.04
146 0.03
147 0.04
148 0.04
149 0.05
150 0.05
151 0.05
152 0.05
153 0.1
154 0.11
155 0.12
156 0.12
157 0.11
158 0.11
159 0.11
160 0.11
161 0.07
162 0.06
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.07
175 0.07
176 0.1
177 0.1
178 0.11
179 0.15
180 0.16
181 0.18
182 0.19
183 0.18
184 0.19
185 0.2
186 0.2
187 0.17
188 0.16
189 0.14
190 0.13
191 0.14
192 0.11
193 0.16
194 0.16
195 0.17
196 0.16
197 0.16
198 0.15
199 0.15
200 0.19
201 0.14
202 0.15
203 0.15
204 0.2
205 0.24
206 0.25
207 0.25
208 0.22
209 0.23
210 0.2
211 0.2
212 0.16
213 0.13
214 0.13
215 0.13
216 0.12
217 0.11
218 0.12
219 0.1
220 0.11
221 0.11
222 0.12
223 0.12
224 0.12
225 0.12
226 0.12
227 0.11
228 0.1
229 0.09
230 0.07
231 0.06
232 0.05
233 0.04
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.02
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.05
246 0.05
247 0.06
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.06
254 0.05
255 0.05
256 0.04
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.1
265 0.12
266 0.12
267 0.14
268 0.19
269 0.22
270 0.25
271 0.3
272 0.3
273 0.34
274 0.38
275 0.4
276 0.35
277 0.34
278 0.31
279 0.25
280 0.19
281 0.15
282 0.13
283 0.1
284 0.1
285 0.1
286 0.09
287 0.09
288 0.11
289 0.14
290 0.16
291 0.22
292 0.26
293 0.3
294 0.34
295 0.4
296 0.4
297 0.42
298 0.38
299 0.34
300 0.31
301 0.35
302 0.33
303 0.31
304 0.31
305 0.28
306 0.31
307 0.34
308 0.34
309 0.27
310 0.24
311 0.2
312 0.2
313 0.21
314 0.17
315 0.13
316 0.14
317 0.13
318 0.14
319 0.15
320 0.14
321 0.12
322 0.13
323 0.13
324 0.13
325 0.13
326 0.12
327 0.12
328 0.11
329 0.1
330 0.1
331 0.1
332 0.07
333 0.07
334 0.06
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.06
346 0.05
347 0.05
348 0.06
349 0.06
350 0.07
351 0.08
352 0.09
353 0.08