Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SX48

Protein Details
Accession A0A086SX48   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
94-122SGFLVRKRSRTGRKILLRRRMKGRREIAQHydrophilic
NLS Segment(s)
PositionSequence
91-119KRRSGFLVRKRSRTGRKILLRRRMKGRRE
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNALTRSFTRLAVRPAGAATKSSRTFTTLSPHRPTVLPSAITTRLPTSFTPSAGAGADLVPTAAITRHPALQAIRCGPRNTMNGATRMVQKRRSGFLVRKRSRTGRKILLRRRMKGRREIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.27
5 0.24
6 0.23
7 0.25
8 0.26
9 0.28
10 0.27
11 0.26
12 0.27
13 0.27
14 0.33
15 0.34
16 0.39
17 0.42
18 0.43
19 0.42
20 0.4
21 0.41
22 0.37
23 0.33
24 0.27
25 0.22
26 0.26
27 0.26
28 0.25
29 0.24
30 0.19
31 0.16
32 0.17
33 0.17
34 0.2
35 0.19
36 0.19
37 0.19
38 0.18
39 0.18
40 0.15
41 0.15
42 0.08
43 0.07
44 0.06
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.05
53 0.06
54 0.08
55 0.08
56 0.1
57 0.11
58 0.14
59 0.17
60 0.2
61 0.24
62 0.25
63 0.26
64 0.27
65 0.31
66 0.3
67 0.31
68 0.33
69 0.31
70 0.3
71 0.31
72 0.31
73 0.33
74 0.39
75 0.39
76 0.39
77 0.42
78 0.44
79 0.46
80 0.5
81 0.49
82 0.51
83 0.57
84 0.62
85 0.64
86 0.67
87 0.7
88 0.75
89 0.77
90 0.76
91 0.75
92 0.74
93 0.78
94 0.81
95 0.84
96 0.85
97 0.84
98 0.84
99 0.86
100 0.86
101 0.83
102 0.83