Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EYA0

Protein Details
Accession A7EYA0    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-37KNSAYYSRYQTKYKRRRSGKTDYYARKRLIHydrophilic
267-293KQESLKYKGRKLTKDEKRERVKAKIAEBasic
NLS Segment(s)
PositionSequence
260-263KKSK
267-291KQESLKYKGRKLTKDEKRERVKAKI
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
IPR025607  Rbsml_L5e_C  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0000027  P:ribosomal large subunit assembly  
GO:0006412  P:translation  
KEGG ssl:SS1G_10315  -  
Pfam View protein in Pfam  
PF14204  Ribosomal_L18_c  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFTKLVKNSAYYSRYQTKYKRRRSGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDIVMQIVTSEITGDKVFCAAYSHELKAYGIEHGLTNWAAAYCTGLLIARRVLKKLGMDKDFTGVEEADGEYQLTEAAGDEERRPFKAFLDVGLHRTSTGARIFGAMKGASDGGILVPHSENRFPGYDMETKELDAETLRKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDEIEADGLEELYQEAHKAIREDPFKKVDGEKKSKDEYKQESLKYKGRKLTKDEKRERVKAKIAELRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.56
4 0.61
5 0.64
6 0.71
7 0.79
8 0.82
9 0.82
10 0.88
11 0.88
12 0.89
13 0.88
14 0.88
15 0.88
16 0.88
17 0.87
18 0.85
19 0.79
20 0.72
21 0.64
22 0.63
23 0.63
24 0.62
25 0.63
26 0.66
27 0.72
28 0.72
29 0.74
30 0.75
31 0.74
32 0.72
33 0.68
34 0.65
35 0.6
36 0.65
37 0.66
38 0.61
39 0.6
40 0.57
41 0.6
42 0.54
43 0.58
44 0.48
45 0.44
46 0.4
47 0.33
48 0.28
49 0.19
50 0.16
51 0.1
52 0.09
53 0.08
54 0.08
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.06
63 0.09
64 0.08
65 0.14
66 0.17
67 0.18
68 0.18
69 0.19
70 0.19
71 0.18
72 0.18
73 0.13
74 0.1
75 0.09
76 0.08
77 0.08
78 0.1
79 0.08
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.1
93 0.14
94 0.15
95 0.16
96 0.17
97 0.18
98 0.22
99 0.28
100 0.33
101 0.3
102 0.31
103 0.3
104 0.32
105 0.3
106 0.26
107 0.2
108 0.13
109 0.1
110 0.09
111 0.08
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.04
122 0.05
123 0.06
124 0.07
125 0.11
126 0.12
127 0.13
128 0.15
129 0.15
130 0.14
131 0.19
132 0.19
133 0.17
134 0.21
135 0.21
136 0.21
137 0.21
138 0.21
139 0.15
140 0.15
141 0.13
142 0.11
143 0.11
144 0.09
145 0.08
146 0.09
147 0.1
148 0.1
149 0.12
150 0.09
151 0.08
152 0.08
153 0.08
154 0.07
155 0.06
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.07
163 0.08
164 0.09
165 0.09
166 0.11
167 0.12
168 0.12
169 0.14
170 0.16
171 0.19
172 0.21
173 0.23
174 0.21
175 0.2
176 0.2
177 0.18
178 0.14
179 0.11
180 0.11
181 0.09
182 0.12
183 0.11
184 0.11
185 0.11
186 0.13
187 0.14
188 0.14
189 0.15
190 0.13
191 0.16
192 0.16
193 0.16
194 0.13
195 0.12
196 0.09
197 0.07
198 0.06
199 0.04
200 0.04
201 0.05
202 0.06
203 0.09
204 0.1
205 0.11
206 0.13
207 0.14
208 0.15
209 0.17
210 0.2
211 0.18
212 0.23
213 0.25
214 0.27
215 0.26
216 0.24
217 0.22
218 0.18
219 0.17
220 0.1
221 0.08
222 0.05
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.06
231 0.07
232 0.09
233 0.11
234 0.14
235 0.21
236 0.29
237 0.31
238 0.36
239 0.39
240 0.39
241 0.41
242 0.46
243 0.46
244 0.49
245 0.56
246 0.57
247 0.59
248 0.66
249 0.69
250 0.69
251 0.7
252 0.68
253 0.68
254 0.69
255 0.69
256 0.69
257 0.69
258 0.7
259 0.69
260 0.69
261 0.68
262 0.69
263 0.7
264 0.71
265 0.75
266 0.78
267 0.8
268 0.83
269 0.85
270 0.86
271 0.88
272 0.86
273 0.84
274 0.83
275 0.77
276 0.77