Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086SZH7

Protein Details
Accession A0A086SZH7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-122RNPSLPQGKEKRINRPRLRNASPQPTRHydrophilic
NLS Segment(s)
PositionSequence
104-113KEKRINRPRL
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MATPQAVLSPSQGISPKTVVANPKDSSNKEYFEAGGSTTSAKTDDSIDSSDFKSDNFSDSTTGAVKASDAPSCGGTEEKKDDGLKRKSSVSIQLPRNPSLPQGKEKRINRPRLRNASPQPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.2
5 0.23
6 0.26
7 0.27
8 0.33
9 0.31
10 0.37
11 0.4
12 0.41
13 0.44
14 0.42
15 0.39
16 0.34
17 0.34
18 0.28
19 0.24
20 0.22
21 0.16
22 0.13
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.1
33 0.12
34 0.12
35 0.14
36 0.14
37 0.14
38 0.13
39 0.12
40 0.13
41 0.11
42 0.12
43 0.11
44 0.12
45 0.11
46 0.11
47 0.13
48 0.1
49 0.1
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.09
63 0.12
64 0.15
65 0.15
66 0.17
67 0.19
68 0.24
69 0.32
70 0.39
71 0.41
72 0.4
73 0.42
74 0.42
75 0.42
76 0.45
77 0.44
78 0.46
79 0.48
80 0.52
81 0.54
82 0.53
83 0.52
84 0.45
85 0.41
86 0.42
87 0.4
88 0.42
89 0.47
90 0.54
91 0.62
92 0.67
93 0.72
94 0.73
95 0.79
96 0.8
97 0.83
98 0.85
99 0.86
100 0.87
101 0.86
102 0.86