Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A095C403

Protein Details
Accession A0A095C403    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-104PLDLRYKKTRAIRRRLTTKESHydrophilic
107-127ITEKQHKKNIHFPKRKIALKAHydrophilic
NLS Segment(s)
PositionSequence
90-127KKTRAIRRRLTTKESSAITEKQHKKNIHFPKRKIALKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MASSSSKIRAFELQSKSKQDLLEQLTELKTELASLRVQKIAGGSASKLTKINTVRKSIARILTVINQKQRQNLREFYKKSKYLPLDLRYKKTRAIRRRLTTKESSAITEKQHKKNIHFPKRKIALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.57
4 0.54
5 0.49
6 0.42
7 0.42
8 0.38
9 0.35
10 0.31
11 0.31
12 0.27
13 0.27
14 0.25
15 0.17
16 0.12
17 0.1
18 0.1
19 0.09
20 0.11
21 0.13
22 0.15
23 0.16
24 0.16
25 0.15
26 0.15
27 0.15
28 0.13
29 0.12
30 0.1
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.18
37 0.23
38 0.31
39 0.32
40 0.36
41 0.38
42 0.39
43 0.42
44 0.41
45 0.38
46 0.3
47 0.26
48 0.23
49 0.26
50 0.29
51 0.28
52 0.29
53 0.31
54 0.32
55 0.37
56 0.41
57 0.4
58 0.4
59 0.44
60 0.45
61 0.5
62 0.53
63 0.55
64 0.58
65 0.57
66 0.54
67 0.56
68 0.52
69 0.5
70 0.54
71 0.52
72 0.54
73 0.56
74 0.61
75 0.58
76 0.56
77 0.55
78 0.56
79 0.6
80 0.6
81 0.65
82 0.69
83 0.73
84 0.81
85 0.81
86 0.8
87 0.77
88 0.71
89 0.66
90 0.58
91 0.52
92 0.47
93 0.43
94 0.42
95 0.46
96 0.5
97 0.53
98 0.6
99 0.61
100 0.63
101 0.69
102 0.75
103 0.76
104 0.77
105 0.74
106 0.77
107 0.81