Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A095C767

Protein Details
Accession A0A095C767    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTAHNQNKKAHRNKIQRPKTNKYHSLKHydrophilic
NLS Segment(s)
PositionSequence
14-45KKAHRNKIQRPKTNKYHSLKGVDPKFRRNARF
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQNKKAHRNKIQRPKTNKYHSLKGVDPKFRRNARFAAQGSAKAIREAKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.82
4 0.82
5 0.81
6 0.83
7 0.87
8 0.88
9 0.87
10 0.87
11 0.86
12 0.86
13 0.84
14 0.83
15 0.77
16 0.74
17 0.68
18 0.64
19 0.58
20 0.57
21 0.55
22 0.54
23 0.52
24 0.51
25 0.55
26 0.57
27 0.58
28 0.53
29 0.51
30 0.48
31 0.54
32 0.49
33 0.48
34 0.44
35 0.42
36 0.41
37 0.41
38 0.36
39 0.3
40 0.31
41 0.25