Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6DGL7

Protein Details
Accession A0A0L6DGL7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-69GLPLKKPKRYYDPTRPRPNNTPVPHydrophilic
NLS Segment(s)
PositionSequence
48-53PLKKPK
Subcellular Location(s) plas 10, mito 8, extr 5, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MVKSALFFFTFMAFATFVCQAAEAPAPGAISSRDEYLSNAERLRRGLPLKKPKRYYDPTRPRPNNTPVPSPMKIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.09
5 0.09
6 0.09
7 0.07
8 0.09
9 0.1
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.08
16 0.06
17 0.08
18 0.09
19 0.09
20 0.09
21 0.1
22 0.1
23 0.14
24 0.16
25 0.15
26 0.16
27 0.16
28 0.16
29 0.18
30 0.18
31 0.19
32 0.21
33 0.27
34 0.36
35 0.46
36 0.55
37 0.63
38 0.68
39 0.7
40 0.75
41 0.77
42 0.77
43 0.77
44 0.79
45 0.8
46 0.85
47 0.85
48 0.83
49 0.82
50 0.81
51 0.8
52 0.74
53 0.71
54 0.67
55 0.68