Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C8B6

Protein Details
Accession A0A095C8B6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-172MASNSKAKKGKGKGKGKGKGKGKGKKBasic
NLS Segment(s)
PositionSequence
151-172SKAKKGKGKGKGKGKGKGKGKK
Subcellular Location(s) mito 13.5, cyto_mito 10.5, cyto 6.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MGLFDIFSCCGSRRDKHKDTEPASESATLLPPARAESIVSADSLTGYGATEQHGLTDEQRTRVAAIGREVGSYMLSVSTSPQNRSSSPARRFSTSSAGSSRPPSPSPNRPETTPANGKLEAPNGSHEPKGDEEDGVVRKNLFPGGNMASNSKAKKGKGKGKGKGKGKGKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.61
4 0.69
5 0.74
6 0.73
7 0.76
8 0.69
9 0.61
10 0.56
11 0.49
12 0.39
13 0.3
14 0.27
15 0.19
16 0.16
17 0.14
18 0.13
19 0.13
20 0.14
21 0.13
22 0.12
23 0.11
24 0.13
25 0.13
26 0.13
27 0.11
28 0.1
29 0.1
30 0.09
31 0.08
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.07
40 0.09
41 0.09
42 0.1
43 0.16
44 0.17
45 0.18
46 0.18
47 0.18
48 0.18
49 0.2
50 0.21
51 0.15
52 0.15
53 0.17
54 0.17
55 0.16
56 0.16
57 0.13
58 0.11
59 0.1
60 0.08
61 0.04
62 0.04
63 0.04
64 0.05
65 0.1
66 0.12
67 0.14
68 0.17
69 0.19
70 0.2
71 0.24
72 0.3
73 0.34
74 0.38
75 0.45
76 0.42
77 0.43
78 0.44
79 0.42
80 0.43
81 0.35
82 0.32
83 0.26
84 0.26
85 0.25
86 0.27
87 0.26
88 0.22
89 0.21
90 0.25
91 0.29
92 0.36
93 0.42
94 0.47
95 0.47
96 0.45
97 0.49
98 0.48
99 0.49
100 0.47
101 0.43
102 0.39
103 0.37
104 0.37
105 0.34
106 0.33
107 0.27
108 0.21
109 0.21
110 0.21
111 0.23
112 0.22
113 0.21
114 0.2
115 0.2
116 0.23
117 0.21
118 0.17
119 0.16
120 0.21
121 0.23
122 0.21
123 0.2
124 0.17
125 0.17
126 0.18
127 0.21
128 0.15
129 0.14
130 0.17
131 0.2
132 0.23
133 0.24
134 0.24
135 0.25
136 0.3
137 0.31
138 0.33
139 0.35
140 0.34
141 0.43
142 0.51
143 0.57
144 0.62
145 0.71
146 0.74
147 0.8
148 0.86
149 0.85
150 0.85
151 0.84
152 0.83