Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F6D5

Protein Details
Accession A7F6D5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
210-243SSSTSNSKSKKSKRGAQEKKSKSKLKKVKSKSKNHydrophilic
NLS Segment(s)
PositionSequence
217-243KSKKSKRGAQEKKSKSKLKKVKSKSKN
Subcellular Location(s) nucl 20.5, mito_nucl 11, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0000178  C:exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0010468  P:regulation of gene expression  
KEGG ssl:SS1G_13164  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDPTKILSLLEQLDDDIDDIEDAVAPFIQKTIPEFASKLPLLDKAKLYTLVTYAIESILFSYLRLNGVNAREHSVFTELTRMKQYFEKIKLTENPPVAVASDRSLKLAKGAAGRFIKAGLSGNDKYDLQRAEQMAKERAKSHIRFEELSKKRKGNEETTTSNSAKSKTSDESDDSDSSSDSSDEPDAIAHKSKKSKTAKVAAPVESMEDSSSTSNSKSKKSKRGAQEKKSKSKLKKVKSKSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.08
5 0.06
6 0.06
7 0.06
8 0.07
9 0.06
10 0.07
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.07
17 0.1
18 0.15
19 0.16
20 0.18
21 0.2
22 0.21
23 0.27
24 0.27
25 0.25
26 0.21
27 0.27
28 0.28
29 0.31
30 0.32
31 0.27
32 0.29
33 0.3
34 0.29
35 0.23
36 0.21
37 0.19
38 0.17
39 0.15
40 0.13
41 0.11
42 0.1
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.1
51 0.1
52 0.1
53 0.13
54 0.16
55 0.2
56 0.2
57 0.23
58 0.22
59 0.23
60 0.23
61 0.21
62 0.19
63 0.14
64 0.22
65 0.18
66 0.2
67 0.24
68 0.23
69 0.23
70 0.26
71 0.31
72 0.3
73 0.34
74 0.38
75 0.34
76 0.39
77 0.43
78 0.43
79 0.45
80 0.38
81 0.34
82 0.28
83 0.28
84 0.23
85 0.17
86 0.14
87 0.1
88 0.13
89 0.12
90 0.13
91 0.14
92 0.13
93 0.13
94 0.14
95 0.15
96 0.16
97 0.16
98 0.21
99 0.21
100 0.22
101 0.2
102 0.19
103 0.17
104 0.12
105 0.14
106 0.08
107 0.13
108 0.13
109 0.14
110 0.15
111 0.15
112 0.15
113 0.17
114 0.17
115 0.12
116 0.15
117 0.15
118 0.17
119 0.19
120 0.21
121 0.24
122 0.26
123 0.26
124 0.24
125 0.29
126 0.34
127 0.34
128 0.37
129 0.36
130 0.37
131 0.37
132 0.4
133 0.45
134 0.44
135 0.49
136 0.49
137 0.46
138 0.46
139 0.52
140 0.53
141 0.5
142 0.5
143 0.5
144 0.49
145 0.52
146 0.54
147 0.47
148 0.44
149 0.38
150 0.32
151 0.28
152 0.25
153 0.24
154 0.22
155 0.24
156 0.25
157 0.26
158 0.28
159 0.3
160 0.29
161 0.26
162 0.23
163 0.2
164 0.17
165 0.15
166 0.12
167 0.08
168 0.09
169 0.09
170 0.08
171 0.08
172 0.09
173 0.09
174 0.11
175 0.18
176 0.18
177 0.24
178 0.32
179 0.34
180 0.43
181 0.5
182 0.57
183 0.59
184 0.66
185 0.66
186 0.68
187 0.71
188 0.63
189 0.57
190 0.48
191 0.42
192 0.33
193 0.27
194 0.18
195 0.13
196 0.12
197 0.11
198 0.12
199 0.11
200 0.13
201 0.17
202 0.2
203 0.29
204 0.38
205 0.47
206 0.56
207 0.64
208 0.71
209 0.77
210 0.85
211 0.88
212 0.88
213 0.89
214 0.9
215 0.91
216 0.92
217 0.91
218 0.89
219 0.89
220 0.89
221 0.89
222 0.89
223 0.89