Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095D9K2

Protein Details
Accession A0A095D9K2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
92-123TAPRKVAVKRVERRERWRGRKWVKRRGAIVHEBasic
NLS Segment(s)
PositionSequence
94-119PRKVAVKRVERRERWRGRKWVKRRGA
Subcellular Location(s) cyto 14.5, cyto_pero 8.5, mito 8, nucl 3
Family & Domain DBs
Amino Acid Sequences MSTPYFSFASAKNIIKRYLAGGEKDAVSVIVTNGDSTHKYLYNRTSKWCYNRRNASQLIGVLWKAIIEIRPGDSNWVSPEARAGHGKATMMTAPRKVAVKRVERRERWRGRKWVKRRGAIVHEGNEMRGGYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.37
4 0.34
5 0.35
6 0.33
7 0.28
8 0.27
9 0.28
10 0.27
11 0.26
12 0.22
13 0.15
14 0.12
15 0.1
16 0.08
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.1
23 0.11
24 0.14
25 0.15
26 0.16
27 0.21
28 0.28
29 0.36
30 0.37
31 0.41
32 0.45
33 0.48
34 0.56
35 0.61
36 0.6
37 0.61
38 0.69
39 0.68
40 0.67
41 0.63
42 0.56
43 0.49
44 0.41
45 0.33
46 0.24
47 0.19
48 0.12
49 0.1
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.06
56 0.07
57 0.08
58 0.08
59 0.11
60 0.11
61 0.11
62 0.11
63 0.14
64 0.13
65 0.12
66 0.15
67 0.14
68 0.16
69 0.17
70 0.16
71 0.14
72 0.15
73 0.15
74 0.12
75 0.13
76 0.12
77 0.14
78 0.16
79 0.16
80 0.16
81 0.18
82 0.22
83 0.21
84 0.27
85 0.32
86 0.4
87 0.47
88 0.57
89 0.66
90 0.7
91 0.78
92 0.82
93 0.84
94 0.84
95 0.85
96 0.85
97 0.85
98 0.88
99 0.9
100 0.9
101 0.88
102 0.87
103 0.83
104 0.81
105 0.78
106 0.76
107 0.72
108 0.65
109 0.62
110 0.54
111 0.48
112 0.41
113 0.34