FuNGI

A0A095EJE7

Protein Details

Accession

A0A095EJE7

Localization Confidence

Low

Confidence Score

8.8

NoLS Segment(s)

Position	Sequence	Protein Nature
1-24	MVKDKKQNKKRKLNGRGNEPKPGA	Basic

NLS Segment(s)

Position	Sequence
5-20	KKQNKKRKLNGRGNEP

Subcellular Location(s)

cyto 9.5, mito 8, cyto_nucl 6.5, pero 5, nucl 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR005123 Oxoglu/Fe-dep_dioxygenase IPR045054 P4HA-like IPR006620 Pro_4_hyd_alph
Gene Ontology	GO:0051213 F:dioxygenase activity GO:0005506 F:iron ion binding GO:0031418 F:L-ascorbic acid binding GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
PROSITE	View protein in PROSITE PS51471 FE2OG_OXY

Amino Acid Sequences

MVKDKKQNKKRKLNGRGNEPKPGASLPTPPGDTSSSSSLIEPEELETAIYVLKTLCEFPEELSDKKYKELKRSVYDLHRVMADGATLGASLTSKISAALQDYRFSDALILLFEMYTRRLAPKLGALQRWVRECDATSAADGSPGDPEALKCLDLILRIANMTNANEQAQSAPAKSSSSVIHHKKPWVARGPIEGEIAIWERMQKGTLFDGETPPKPYPNFRPVHHVPAAERRPPNLYDSTVYGSSPSAITLTPKECRPRQPSKMVVPGVPGAFMVLDVFTSEECLQIVKAAEAIGFEKDEAAAGSAIMKTSILARNFVWLADKPFLEHFYAQILPFVPQTAPVSPDGQGGGKVRGINARFRVYQYNENQLYRPHIDGAWPAAGLHPETGEYLHDSSPPDDPLWSRYTLLVYLNSDIPDDTGCTTFFLPSETMGVMDATSVKPVQGAVLCFPHGDTQGSLLHEGSAVGAGGGKLVIRTELLFEAQGFGQFKPPTNGNVTAQS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.92
2	0.92
3	0.92
4	0.86
5	0.85
6	0.76
7	0.66
8	0.58
9	0.5
10	0.44
11	0.36
12	0.37
13	0.31
14	0.35
15	0.35
16	0.32
17	0.34
18	0.31
19	0.31
20	0.29
21	0.29
22	0.26
23	0.25
24	0.25
25	0.23
26	0.22
27	0.2
28	0.16
29	0.14
30	0.13
31	0.12
32	0.11
33	0.1
34	0.09
35	0.09
36	0.08
37	0.07
38	0.06
39	0.07
40	0.08
41	0.1
42	0.1
43	0.11
44	0.12
45	0.13
46	0.23
47	0.25
48	0.26
49	0.3
50	0.34
51	0.32
52	0.39
53	0.45
54	0.41
55	0.48
56	0.56
57	0.6
58	0.61
59	0.66
60	0.68
61	0.68
62	0.71
63	0.62
64	0.55
65	0.46
66	0.4
67	0.35
68	0.27
69	0.19
70	0.11
71	0.09
72	0.07
73	0.06
74	0.05
75	0.04
76	0.04
77	0.05
78	0.05
79	0.05
80	0.05
81	0.06
82	0.07
83	0.08
84	0.11
85	0.18
86	0.18
87	0.21
88	0.22
89	0.26
90	0.25
91	0.24
92	0.21
93	0.15
94	0.14
95	0.12
96	0.11
97	0.07
98	0.07
99	0.07
100	0.07
101	0.07
102	0.08
103	0.09
104	0.11
105	0.12
106	0.13
107	0.14
108	0.2
109	0.28
110	0.33
111	0.34
112	0.36
113	0.4
114	0.44
115	0.46
116	0.42
117	0.34
118	0.29
119	0.28
120	0.29
121	0.25
122	0.21
123	0.18
124	0.17
125	0.16
126	0.16
127	0.14
128	0.11
129	0.09
130	0.09
131	0.08
132	0.08
133	0.08
134	0.09
135	0.1
136	0.1
137	0.09
138	0.09
139	0.1
140	0.1
141	0.11
142	0.08
143	0.08
144	0.08
145	0.09
146	0.09
147	0.1
148	0.11
149	0.11
150	0.11
151	0.12
152	0.12
153	0.12
154	0.11
155	0.12
156	0.12
157	0.1
158	0.1
159	0.1
160	0.11
161	0.11
162	0.12
163	0.12
164	0.16
165	0.25
166	0.29
167	0.35
168	0.38
169	0.41
170	0.45
171	0.47
172	0.49
173	0.48
174	0.46
175	0.41
176	0.42
177	0.42
178	0.39
179	0.35
180	0.27
181	0.19
182	0.17
183	0.17
184	0.12
185	0.09
186	0.08
187	0.08
188	0.08
189	0.09
190	0.08
191	0.09
192	0.1
193	0.11
194	0.12
195	0.12
196	0.17
197	0.19
198	0.2
199	0.22
200	0.21
201	0.22
202	0.22
203	0.26
204	0.29
205	0.35
206	0.37
207	0.35
208	0.43
209	0.43
210	0.5
211	0.47
212	0.41
213	0.34
214	0.39
215	0.43
216	0.4
217	0.38
218	0.32
219	0.33
220	0.33
221	0.34
222	0.26
223	0.24
224	0.18
225	0.2
226	0.21
227	0.18
228	0.17
229	0.14
230	0.12
231	0.1
232	0.09
233	0.07
234	0.05
235	0.05
236	0.06
237	0.08
238	0.11
239	0.12
240	0.16
241	0.21
242	0.24
243	0.33
244	0.4
245	0.47
246	0.51
247	0.57
248	0.6
249	0.6
250	0.64
251	0.57
252	0.49
253	0.42
254	0.37
255	0.29
256	0.23
257	0.17
258	0.09
259	0.07
260	0.07
261	0.05
262	0.03
263	0.03
264	0.03
265	0.03
266	0.03
267	0.05
268	0.05
269	0.06
270	0.06
271	0.06
272	0.06
273	0.07
274	0.08
275	0.05
276	0.06
277	0.06
278	0.06
279	0.06
280	0.07
281	0.06
282	0.06
283	0.06
284	0.05
285	0.05
286	0.05
287	0.05
288	0.05
289	0.04
290	0.04
291	0.05
292	0.05
293	0.05
294	0.05
295	0.05
296	0.04
297	0.08
298	0.13
299	0.12
300	0.14
301	0.14
302	0.17
303	0.17
304	0.17
305	0.17
306	0.13
307	0.16
308	0.17
309	0.17
310	0.15
311	0.17
312	0.18
313	0.18
314	0.17
315	0.13
316	0.14
317	0.16
318	0.14
319	0.15
320	0.13
321	0.12
322	0.12
323	0.13
324	0.09
325	0.1
326	0.12
327	0.12
328	0.13
329	0.14
330	0.15
331	0.14
332	0.15
333	0.14
334	0.13
335	0.14
336	0.14
337	0.14
338	0.15
339	0.15
340	0.15
341	0.19
342	0.21
343	0.24
344	0.27
345	0.3
346	0.3
347	0.32
348	0.38
349	0.37
350	0.44
351	0.41
352	0.47
353	0.46
354	0.46
355	0.45
356	0.4
357	0.41
358	0.35
359	0.32
360	0.24
361	0.2
362	0.2
363	0.21
364	0.22
365	0.17
366	0.15
367	0.13
368	0.13
369	0.13
370	0.13
371	0.11
372	0.08
373	0.08
374	0.08
375	0.08
376	0.08
377	0.1
378	0.11
379	0.12
380	0.14
381	0.15
382	0.16
383	0.18
384	0.19
385	0.17
386	0.16
387	0.17
388	0.19
389	0.21
390	0.21
391	0.19
392	0.19
393	0.2
394	0.2
395	0.21
396	0.2
397	0.18
398	0.19
399	0.2
400	0.19
401	0.18
402	0.16
403	0.15
404	0.12
405	0.12
406	0.11
407	0.1
408	0.1
409	0.12
410	0.12
411	0.12
412	0.12
413	0.13
414	0.12
415	0.11
416	0.13
417	0.11
418	0.11
419	0.11
420	0.11
421	0.08
422	0.08
423	0.09
424	0.07
425	0.09
426	0.09
427	0.09
428	0.09
429	0.09
430	0.12
431	0.13
432	0.15
433	0.16
434	0.19
435	0.19
436	0.19
437	0.2
438	0.2
439	0.19
440	0.19
441	0.16
442	0.16
443	0.19
444	0.21
445	0.21
446	0.18
447	0.16
448	0.15
449	0.14
450	0.11
451	0.08
452	0.06
453	0.05
454	0.06
455	0.06
456	0.06
457	0.06
458	0.06
459	0.05
460	0.06
461	0.07
462	0.07
463	0.08
464	0.1
465	0.12
466	0.13
467	0.13
468	0.13
469	0.15
470	0.15
471	0.19
472	0.18
473	0.17
474	0.23
475	0.25
476	0.28
477	0.31
478	0.33
479	0.33
480	0.37
481	0.42

A0A095EJE7

3D AlphaFold-predicted Structure Viewer