Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C5J6

Protein Details
Accession A0A095C5J6   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-126APSTFIRPPKPPKKFRGWGPKIQHGVHydrophilic
NLS Segment(s)
PositionSequence
108-121PPKPPKKFRGWGPK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MMILPSLRASSSRLAQPRLFSTTSRMLQKAPLAASTETATPEELLTKIGRNADKKLTPFAESWDKLNEVWLKTKKMNDLGLATKEKRYILWAFSRYSQGSAPSTFIRPPKPPKKFRGWGPKIQHGVRVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.41
4 0.43
5 0.43
6 0.41
7 0.34
8 0.34
9 0.37
10 0.4
11 0.41
12 0.38
13 0.33
14 0.35
15 0.37
16 0.34
17 0.27
18 0.24
19 0.22
20 0.21
21 0.21
22 0.19
23 0.17
24 0.14
25 0.14
26 0.13
27 0.1
28 0.1
29 0.09
30 0.08
31 0.09
32 0.09
33 0.09
34 0.11
35 0.15
36 0.18
37 0.2
38 0.23
39 0.27
40 0.3
41 0.3
42 0.33
43 0.3
44 0.28
45 0.26
46 0.27
47 0.29
48 0.26
49 0.26
50 0.23
51 0.23
52 0.2
53 0.24
54 0.23
55 0.16
56 0.23
57 0.25
58 0.26
59 0.28
60 0.31
61 0.31
62 0.32
63 0.32
64 0.27
65 0.27
66 0.27
67 0.29
68 0.31
69 0.28
70 0.26
71 0.26
72 0.24
73 0.21
74 0.22
75 0.2
76 0.2
77 0.26
78 0.27
79 0.27
80 0.29
81 0.34
82 0.3
83 0.29
84 0.26
85 0.22
86 0.22
87 0.21
88 0.22
89 0.2
90 0.21
91 0.24
92 0.27
93 0.3
94 0.35
95 0.45
96 0.53
97 0.62
98 0.68
99 0.73
100 0.79
101 0.81
102 0.83
103 0.84
104 0.81
105 0.81
106 0.8
107 0.82
108 0.79
109 0.73
110 0.71