Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C1D9

Protein Details
Accession A0A095C1D9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
333-369MYLPKREREIRRSERIRMRKWERRRRMRESELKNGEYBasic
NLS Segment(s)
PositionSequence
336-360PKREREIRRSERIRMRKWERRRRMR
Subcellular Location(s) cysk 15, nucl 4, mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MGMPMGMGIPMAGPMPGIMPGMPGVGNLPRGWFGRDQLGRGPGGVGSSQPYRPPDPSALPPMPFGLPFIARPGQEGFDQYGRMLPPALPEGWDGWGRPIVAAGANTPAPATTPPQEPPAPLPQPHAHDTPLAAQPSGMGGRTYGYPTQSGSQTSTLMSKTATGRPDQPPCFDRPPAQQESYYRYEPFEAFSFSANLLNHPHQLHLPPELVSRDVNEQDWMKFIEDLSREALHGASHSLTRQARGEHTGPDPLLSEAVHSLLASWAVAFFAPRGIRVYAAQNGKKIIPPPIEPPHSKRGYSHASEWSDNESASDDDFGYGSEDDEEREARKSDMYLPKREREIRRSERIRMRKWERRRRMRESELKNGEYRGAWEIHFVPATPTIWQRGARPRTYGEPVVRLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.07
5 0.06
6 0.07
7 0.08
8 0.09
9 0.09
10 0.08
11 0.09
12 0.11
13 0.14
14 0.13
15 0.14
16 0.17
17 0.18
18 0.22
19 0.22
20 0.22
21 0.3
22 0.32
23 0.33
24 0.35
25 0.38
26 0.35
27 0.33
28 0.31
29 0.21
30 0.2
31 0.17
32 0.13
33 0.13
34 0.16
35 0.18
36 0.21
37 0.25
38 0.28
39 0.3
40 0.34
41 0.35
42 0.37
43 0.41
44 0.46
45 0.45
46 0.42
47 0.4
48 0.38
49 0.33
50 0.28
51 0.24
52 0.18
53 0.16
54 0.15
55 0.19
56 0.21
57 0.19
58 0.22
59 0.23
60 0.21
61 0.21
62 0.22
63 0.21
64 0.19
65 0.2
66 0.18
67 0.19
68 0.18
69 0.18
70 0.16
71 0.13
72 0.14
73 0.16
74 0.16
75 0.14
76 0.14
77 0.15
78 0.16
79 0.17
80 0.15
81 0.14
82 0.16
83 0.15
84 0.14
85 0.13
86 0.11
87 0.11
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.08
95 0.08
96 0.09
97 0.12
98 0.13
99 0.16
100 0.18
101 0.23
102 0.24
103 0.24
104 0.27
105 0.33
106 0.33
107 0.31
108 0.35
109 0.35
110 0.39
111 0.41
112 0.39
113 0.31
114 0.28
115 0.27
116 0.26
117 0.26
118 0.22
119 0.18
120 0.16
121 0.15
122 0.16
123 0.15
124 0.11
125 0.07
126 0.06
127 0.07
128 0.08
129 0.11
130 0.11
131 0.11
132 0.11
133 0.13
134 0.15
135 0.15
136 0.16
137 0.16
138 0.16
139 0.15
140 0.15
141 0.16
142 0.14
143 0.13
144 0.11
145 0.12
146 0.14
147 0.17
148 0.18
149 0.18
150 0.23
151 0.29
152 0.37
153 0.36
154 0.37
155 0.35
156 0.4
157 0.42
158 0.38
159 0.36
160 0.35
161 0.41
162 0.42
163 0.41
164 0.38
165 0.36
166 0.4
167 0.41
168 0.36
169 0.29
170 0.24
171 0.24
172 0.22
173 0.22
174 0.17
175 0.14
176 0.12
177 0.13
178 0.13
179 0.11
180 0.14
181 0.12
182 0.12
183 0.13
184 0.14
185 0.16
186 0.16
187 0.16
188 0.14
189 0.15
190 0.15
191 0.14
192 0.14
193 0.11
194 0.13
195 0.13
196 0.13
197 0.11
198 0.12
199 0.12
200 0.12
201 0.12
202 0.13
203 0.13
204 0.12
205 0.13
206 0.13
207 0.11
208 0.1
209 0.1
210 0.13
211 0.13
212 0.14
213 0.15
214 0.14
215 0.13
216 0.14
217 0.14
218 0.09
219 0.08
220 0.08
221 0.06
222 0.07
223 0.07
224 0.12
225 0.13
226 0.14
227 0.16
228 0.17
229 0.18
230 0.22
231 0.24
232 0.21
233 0.22
234 0.23
235 0.21
236 0.2
237 0.19
238 0.14
239 0.13
240 0.1
241 0.09
242 0.06
243 0.07
244 0.07
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.08
257 0.08
258 0.09
259 0.11
260 0.12
261 0.13
262 0.14
263 0.18
264 0.21
265 0.28
266 0.3
267 0.29
268 0.31
269 0.31
270 0.32
271 0.3
272 0.31
273 0.27
274 0.27
275 0.33
276 0.39
277 0.44
278 0.46
279 0.49
280 0.52
281 0.52
282 0.5
283 0.44
284 0.44
285 0.45
286 0.45
287 0.44
288 0.43
289 0.43
290 0.44
291 0.43
292 0.41
293 0.34
294 0.3
295 0.25
296 0.19
297 0.15
298 0.14
299 0.14
300 0.09
301 0.09
302 0.09
303 0.09
304 0.09
305 0.09
306 0.08
307 0.09
308 0.09
309 0.09
310 0.11
311 0.12
312 0.11
313 0.14
314 0.15
315 0.14
316 0.15
317 0.17
318 0.24
319 0.34
320 0.38
321 0.46
322 0.51
323 0.56
324 0.63
325 0.71
326 0.7
327 0.68
328 0.73
329 0.72
330 0.77
331 0.77
332 0.79
333 0.81
334 0.82
335 0.82
336 0.82
337 0.83
338 0.83
339 0.87
340 0.89
341 0.9
342 0.91
343 0.92
344 0.91
345 0.91
346 0.92
347 0.91
348 0.88
349 0.88
350 0.84
351 0.78
352 0.71
353 0.62
354 0.53
355 0.43
356 0.38
357 0.31
358 0.24
359 0.21
360 0.22
361 0.22
362 0.23
363 0.23
364 0.2
365 0.19
366 0.2
367 0.21
368 0.21
369 0.22
370 0.23
371 0.28
372 0.3
373 0.34
374 0.41
375 0.49
376 0.5
377 0.52
378 0.51
379 0.54
380 0.59
381 0.6
382 0.54
383 0.55