Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095D9G7

Protein Details
Accession A0A095D9G7   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
184-209DNIPCTNIAKDKKKKRRVETGINVSDHydrophilic
221-262DDSIHKKKKRIVKDEEGKSDEKIKAKKNKKKKKDAMDDIFGFBasic
NLS Segment(s)
PositionSequence
194-200DKKKKRR
225-253HKKKKRIVKDEEGKSDEKIKAKKNKKKKK
Subcellular Location(s) nucl 15, mito_nucl 11.666, cyto_nucl 10.666, mito 7, cyto_mito 6.666
Family & Domain DBs
Amino Acid Sequences MIKMLFSAHYITSQIIDLYHFLPLQTTILSIYARLFTVTVSLANSLEMDVEQLLIAAGKVTNGKRRMRPEENQKTNKVATGTLLGGAIKDMGVDVEMGEVIERSRPSQSLGCVSKSTPGSISERSAFSPKPPKPGKVVSSAVAALSSTVDSGINLENDCLEKETTIVSKSVELPPSLQIDQLLDNIPCTNIAKDKKKKRRVETGINVSDAKTPKEDFSIEDDSIHKKKKRIVKDEEGKSDEKIKAKKNKKKKKDAMDDIFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.12
5 0.11
6 0.13
7 0.12
8 0.11
9 0.12
10 0.12
11 0.12
12 0.1
13 0.1
14 0.09
15 0.1
16 0.11
17 0.1
18 0.11
19 0.11
20 0.11
21 0.11
22 0.1
23 0.08
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.1
32 0.08
33 0.08
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.09
47 0.12
48 0.2
49 0.27
50 0.33
51 0.4
52 0.49
53 0.57
54 0.61
55 0.67
56 0.71
57 0.75
58 0.8
59 0.8
60 0.74
61 0.69
62 0.62
63 0.56
64 0.45
65 0.34
66 0.25
67 0.21
68 0.18
69 0.14
70 0.13
71 0.1
72 0.09
73 0.08
74 0.07
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.06
89 0.06
90 0.07
91 0.08
92 0.09
93 0.12
94 0.14
95 0.15
96 0.2
97 0.22
98 0.23
99 0.23
100 0.22
101 0.25
102 0.23
103 0.22
104 0.16
105 0.16
106 0.18
107 0.18
108 0.2
109 0.17
110 0.17
111 0.18
112 0.2
113 0.18
114 0.19
115 0.27
116 0.27
117 0.35
118 0.36
119 0.37
120 0.39
121 0.45
122 0.43
123 0.4
124 0.41
125 0.32
126 0.31
127 0.28
128 0.23
129 0.17
130 0.14
131 0.08
132 0.06
133 0.05
134 0.03
135 0.03
136 0.03
137 0.03
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.08
146 0.08
147 0.07
148 0.06
149 0.07
150 0.08
151 0.09
152 0.09
153 0.1
154 0.09
155 0.1
156 0.13
157 0.16
158 0.17
159 0.16
160 0.16
161 0.18
162 0.22
163 0.2
164 0.18
165 0.14
166 0.14
167 0.14
168 0.14
169 0.14
170 0.1
171 0.1
172 0.1
173 0.1
174 0.1
175 0.1
176 0.1
177 0.16
178 0.24
179 0.34
180 0.43
181 0.55
182 0.65
183 0.74
184 0.82
185 0.84
186 0.87
187 0.86
188 0.87
189 0.86
190 0.86
191 0.79
192 0.72
193 0.64
194 0.53
195 0.5
196 0.4
197 0.32
198 0.24
199 0.22
200 0.21
201 0.23
202 0.23
203 0.2
204 0.25
205 0.29
206 0.26
207 0.26
208 0.27
209 0.31
210 0.36
211 0.42
212 0.4
213 0.39
214 0.47
215 0.54
216 0.63
217 0.67
218 0.7
219 0.73
220 0.79
221 0.83
222 0.85
223 0.8
224 0.71
225 0.63
226 0.61
227 0.55
228 0.52
229 0.5
230 0.51
231 0.57
232 0.66
233 0.74
234 0.78
235 0.85
236 0.88
237 0.92
238 0.93
239 0.94
240 0.94
241 0.95
242 0.92