Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EHT0

Protein Details
Accession A7EHT0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
203-228LLFEKGFRRRNLKDKRHKIPKFILYLHydrophilic
NLS Segment(s)
PositionSequence
210-221RRRNLKDKRHKI
Subcellular Location(s) nucl 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG ssl:SS1G_04872  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MMDEPNADSKFTIFNELPLEIRQMIWKATFRGRVVKVILKSFYHVGNFGSIRQRDKVVFHNSAPYPRTMFGNRESRNTTLLHYTKPCQPNPGNPRLFHPKLDSVTVTFSTEYDSKCLYNWDDLKRVACWDCPALKQTLRTLFLPCLDLFQTYVRQNDDLTQEFLESYDVFGFRNLEHLIIFEEGKEVVPLDGQRRVDYEGVKLLFEKGFRRRNLKDKRHKIPKFILYLDQIDLPPGFQDKFNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.25
5 0.22
6 0.24
7 0.18
8 0.19
9 0.19
10 0.18
11 0.19
12 0.21
13 0.23
14 0.24
15 0.31
16 0.36
17 0.35
18 0.42
19 0.43
20 0.44
21 0.45
22 0.48
23 0.45
24 0.43
25 0.45
26 0.36
27 0.37
28 0.34
29 0.32
30 0.27
31 0.24
32 0.19
33 0.21
34 0.21
35 0.21
36 0.27
37 0.27
38 0.29
39 0.3
40 0.32
41 0.29
42 0.31
43 0.36
44 0.36
45 0.37
46 0.35
47 0.41
48 0.4
49 0.43
50 0.42
51 0.35
52 0.3
53 0.27
54 0.3
55 0.25
56 0.27
57 0.28
58 0.37
59 0.37
60 0.39
61 0.42
62 0.39
63 0.39
64 0.36
65 0.31
66 0.29
67 0.29
68 0.28
69 0.28
70 0.29
71 0.35
72 0.4
73 0.39
74 0.39
75 0.4
76 0.45
77 0.51
78 0.58
79 0.54
80 0.48
81 0.53
82 0.55
83 0.54
84 0.46
85 0.42
86 0.37
87 0.34
88 0.35
89 0.3
90 0.21
91 0.22
92 0.21
93 0.17
94 0.13
95 0.11
96 0.12
97 0.13
98 0.13
99 0.12
100 0.12
101 0.11
102 0.12
103 0.14
104 0.12
105 0.15
106 0.2
107 0.21
108 0.23
109 0.24
110 0.25
111 0.23
112 0.24
113 0.2
114 0.16
115 0.15
116 0.14
117 0.16
118 0.16
119 0.17
120 0.18
121 0.18
122 0.2
123 0.22
124 0.25
125 0.25
126 0.25
127 0.25
128 0.23
129 0.23
130 0.23
131 0.19
132 0.15
133 0.14
134 0.13
135 0.12
136 0.12
137 0.16
138 0.15
139 0.18
140 0.17
141 0.17
142 0.17
143 0.19
144 0.22
145 0.19
146 0.19
147 0.17
148 0.16
149 0.15
150 0.15
151 0.13
152 0.09
153 0.08
154 0.08
155 0.08
156 0.07
157 0.08
158 0.09
159 0.08
160 0.12
161 0.11
162 0.1
163 0.1
164 0.1
165 0.11
166 0.12
167 0.12
168 0.08
169 0.08
170 0.08
171 0.09
172 0.08
173 0.07
174 0.06
175 0.08
176 0.1
177 0.13
178 0.18
179 0.18
180 0.19
181 0.21
182 0.23
183 0.24
184 0.23
185 0.22
186 0.24
187 0.23
188 0.23
189 0.22
190 0.21
191 0.2
192 0.21
193 0.26
194 0.28
195 0.36
196 0.41
197 0.49
198 0.54
199 0.63
200 0.72
201 0.77
202 0.79
203 0.81
204 0.87
205 0.9
206 0.88
207 0.87
208 0.86
209 0.83
210 0.79
211 0.72
212 0.66
213 0.6
214 0.57
215 0.49
216 0.42
217 0.33
218 0.28
219 0.24
220 0.19
221 0.16
222 0.16
223 0.16