Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EBI3

Protein Details
Accession A7EBI3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-102LKETGFPRRSERTRQKGRRQERGKRBasic
NLS Segment(s)
PositionSequence
85-102RRSERTRQKGRRQERGKR
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 4, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
KEGG ssl:SS1G_02669  -  
Amino Acid Sequences MPPTPPQYEWTTNEVREWMAGHFVTRMKRERSYAITVAQQYDGTGRLLFSYTKEDWLEVFERKVYGVMAWILGNDEELKETGFPRRSERTRQKGRRQERGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.25
4 0.22
5 0.16
6 0.14
7 0.14
8 0.13
9 0.14
10 0.17
11 0.21
12 0.25
13 0.3
14 0.31
15 0.35
16 0.37
17 0.39
18 0.42
19 0.44
20 0.41
21 0.36
22 0.36
23 0.34
24 0.32
25 0.27
26 0.22
27 0.15
28 0.14
29 0.12
30 0.09
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.12
38 0.11
39 0.14
40 0.14
41 0.14
42 0.13
43 0.16
44 0.17
45 0.13
46 0.13
47 0.11
48 0.12
49 0.11
50 0.12
51 0.09
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.09
68 0.16
69 0.21
70 0.23
71 0.28
72 0.38
73 0.43
74 0.53
75 0.63
76 0.66
77 0.73
78 0.82
79 0.86
80 0.88
81 0.92
82 0.92