Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095CIS0

Protein Details
Accession A0A095CIS0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-179DEPEREGETKGKRRKKKSRSGNMGVSQABasic
NLS Segment(s)
PositionSequence
160-170TKGKRRKKKSR
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038089  Med31_sf  
IPR008831  Mediator_Med31  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05669  Med31  
Amino Acid Sequences MEALPTILPPPPLPDGSEKPTRSPEKHANLVRFQSELEFIQCLAHPQYLHELHIQGYLGKPAFLNYLKYLEYWREPHYVRFIIYPTCLVYLTLLQTELFRSRLGDMGFITELMRVGSRHHATWRVEKPAGVTQPEEKLAVPMVTLDDDEEEDEPEREGETKGKRRKKKSRSGNMGVSQAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.36
4 0.45
5 0.42
6 0.42
7 0.51
8 0.56
9 0.52
10 0.55
11 0.59
12 0.58
13 0.66
14 0.68
15 0.65
16 0.63
17 0.63
18 0.56
19 0.47
20 0.39
21 0.31
22 0.27
23 0.22
24 0.17
25 0.13
26 0.12
27 0.13
28 0.12
29 0.13
30 0.13
31 0.14
32 0.13
33 0.13
34 0.2
35 0.2
36 0.22
37 0.21
38 0.2
39 0.18
40 0.2
41 0.19
42 0.12
43 0.11
44 0.13
45 0.11
46 0.11
47 0.1
48 0.09
49 0.13
50 0.13
51 0.15
52 0.13
53 0.16
54 0.16
55 0.16
56 0.17
57 0.16
58 0.18
59 0.19
60 0.2
61 0.23
62 0.24
63 0.25
64 0.29
65 0.27
66 0.25
67 0.23
68 0.21
69 0.17
70 0.17
71 0.15
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.11
90 0.11
91 0.11
92 0.1
93 0.11
94 0.11
95 0.1
96 0.1
97 0.07
98 0.07
99 0.06
100 0.07
101 0.05
102 0.07
103 0.14
104 0.16
105 0.17
106 0.2
107 0.26
108 0.28
109 0.37
110 0.41
111 0.4
112 0.4
113 0.39
114 0.39
115 0.4
116 0.4
117 0.33
118 0.29
119 0.26
120 0.28
121 0.29
122 0.26
123 0.19
124 0.17
125 0.16
126 0.14
127 0.11
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.09
136 0.09
137 0.09
138 0.1
139 0.1
140 0.1
141 0.1
142 0.1
143 0.1
144 0.11
145 0.17
146 0.25
147 0.35
148 0.45
149 0.55
150 0.64
151 0.74
152 0.84
153 0.88
154 0.9
155 0.91
156 0.92
157 0.93
158 0.92
159 0.9
160 0.85