Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A095CJ00

Protein Details
Accession A0A095CJ00    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-65LSYRTCVNLRLRRRWRRKRLGWRKPRRQLPHCKESVHydrophilic
NLS Segment(s)
PositionSequence
40-56LRRRWRRKRLGWRKPRR
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MSLSWPFMSTNWRKSLVPLSMTIAASLKNLSYRTCVNLRLRRRWRRKRLGWRKPRRQLPHCKESVNCRLSSTLRPSLASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.42
4 0.37
5 0.31
6 0.31
7 0.31
8 0.31
9 0.28
10 0.21
11 0.16
12 0.15
13 0.14
14 0.1
15 0.09
16 0.1
17 0.1
18 0.12
19 0.13
20 0.16
21 0.18
22 0.24
23 0.3
24 0.37
25 0.43
26 0.51
27 0.6
28 0.67
29 0.76
30 0.81
31 0.84
32 0.87
33 0.91
34 0.92
35 0.93
36 0.93
37 0.94
38 0.94
39 0.94
40 0.93
41 0.93
42 0.92
43 0.9
44 0.9
45 0.88
46 0.87
47 0.8
48 0.74
49 0.67
50 0.66
51 0.66
52 0.59
53 0.51
54 0.42
55 0.42
56 0.42
57 0.46
58 0.44
59 0.42
60 0.39