Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C953

Protein Details
Accession A0A095C953    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-52VQMMDRMMKRLRSRKKRKTGMKKTMRLKTNPPRNLRRRNPVNHNSTSHydrophilic
NLS Segment(s)
PositionSequence
14-43KRLRSRKKRKTGMKKTMRLKTNPPRNLRRR
Subcellular Location(s) nucl 21, mito_nucl 13.499, cyto_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MMMRNVQMMDRMMKRLRSRKKRKTGMKKTMRLKTNPPRNLRRRNPVNHNSTSPPFNLNKPPSIPISLPNCALPRNTIAMLSDSSTNWNLPFQSCANYSSPPRKLKSSNPCGSLGSRTNMTSPRPNRESRRCCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.62
4 0.67
5 0.76
6 0.8
7 0.87
8 0.91
9 0.93
10 0.95
11 0.95
12 0.95
13 0.94
14 0.92
15 0.91
16 0.89
17 0.85
18 0.78
19 0.77
20 0.76
21 0.76
22 0.75
23 0.75
24 0.77
25 0.8
26 0.86
27 0.84
28 0.84
29 0.82
30 0.83
31 0.85
32 0.83
33 0.8
34 0.73
35 0.68
36 0.62
37 0.55
38 0.48
39 0.39
40 0.34
41 0.28
42 0.27
43 0.32
44 0.3
45 0.3
46 0.29
47 0.3
48 0.28
49 0.28
50 0.25
51 0.23
52 0.25
53 0.24
54 0.23
55 0.23
56 0.22
57 0.2
58 0.2
59 0.15
60 0.12
61 0.13
62 0.13
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.11
69 0.09
70 0.11
71 0.12
72 0.11
73 0.1
74 0.11
75 0.11
76 0.1
77 0.13
78 0.12
79 0.15
80 0.15
81 0.18
82 0.19
83 0.22
84 0.26
85 0.32
86 0.39
87 0.42
88 0.44
89 0.47
90 0.5
91 0.57
92 0.63
93 0.65
94 0.64
95 0.61
96 0.6
97 0.57
98 0.54
99 0.5
100 0.43
101 0.36
102 0.32
103 0.29
104 0.31
105 0.33
106 0.36
107 0.39
108 0.42
109 0.48
110 0.51
111 0.59
112 0.66
113 0.73