Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C8Q6

Protein Details
Accession A0A095C8Q6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKNPWRLSPTRKANQRKRLKRVDDVIHydrophilic
76-95FSKRDPGYRKSQHKVPKWTRBasic
NLS Segment(s)
PositionSequence
32-33RK
Subcellular Location(s) mito 23, cyto_mito 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPTSFVSGGLLWKNPWRLSPTRKANQRKRLKRVDDVISMVAESGVTTRSLVKALALPTEAEMSPRDKYTTFSKRDPGYRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.24
5 0.28
6 0.27
7 0.27
8 0.29
9 0.35
10 0.41
11 0.5
12 0.56
13 0.6
14 0.69
15 0.77
16 0.81
17 0.84
18 0.87
19 0.87
20 0.86
21 0.88
22 0.84
23 0.81
24 0.77
25 0.72
26 0.64
27 0.56
28 0.47
29 0.37
30 0.3
31 0.23
32 0.15
33 0.09
34 0.06
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.08
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.1
52 0.09
53 0.09
54 0.11
55 0.12
56 0.13
57 0.14
58 0.12
59 0.16
60 0.24
61 0.32
62 0.35
63 0.38
64 0.44
65 0.48
66 0.56
67 0.61
68 0.57
69 0.59
70 0.63
71 0.69
72 0.68
73 0.72
74 0.73
75 0.75
76 0.8
77 0.79
78 0.8
79 0.76
80 0.78
81 0.79
82 0.78
83 0.77
84 0.75
85 0.76