Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A095C8Y2

Protein Details
Accession A0A095C8Y2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LKLRGKTFWRHDWKKCKSSKTPKRLMLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 11.666, cyto_nucl 6.666, cyto 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MRRIGRPLKTFLKLRGKTFWRHDWKKCKSSKTPKRLMLCSRPLMVGMMRTRTTQGLGRDVSYPVNIKTTVLIDSQASTLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.6
4 0.61
5 0.64
6 0.64
7 0.64
8 0.68
9 0.74
10 0.75
11 0.79
12 0.81
13 0.81
14 0.79
15 0.79
16 0.81
17 0.83
18 0.82
19 0.82
20 0.81
21 0.79
22 0.77
23 0.74
24 0.71
25 0.66
26 0.58
27 0.5
28 0.42
29 0.36
30 0.3
31 0.23
32 0.2
33 0.15
34 0.16
35 0.16
36 0.17
37 0.18
38 0.17
39 0.19
40 0.18
41 0.19
42 0.21
43 0.21
44 0.22
45 0.22
46 0.23
47 0.22
48 0.2
49 0.2
50 0.15
51 0.17
52 0.16
53 0.15
54 0.16
55 0.16
56 0.16
57 0.14
58 0.15
59 0.13
60 0.14