Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6DHA5

Protein Details
Accession A0A0L6DHA5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-111KVELEKEKEREKKRKDKFDLERFYGGBasic
NLS Segment(s)
PositionSequence
89-101LEKEKEREKKRKD
Subcellular Location(s) mito 18.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MTKRRERASMEADGNWTRSVPRVRVGVLELRLLQSRKSPQNASSSSWDIAQVGQVVDWVTNFLPGGKTTEAGKRQLEEARMEKEGKVELEKEKEREKKRKDKFDLERFYGGLMIKLRDDGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.32
3 0.27
4 0.19
5 0.22
6 0.26
7 0.23
8 0.26
9 0.27
10 0.27
11 0.29
12 0.31
13 0.3
14 0.26
15 0.26
16 0.22
17 0.21
18 0.24
19 0.23
20 0.21
21 0.21
22 0.27
23 0.31
24 0.36
25 0.37
26 0.36
27 0.44
28 0.46
29 0.44
30 0.41
31 0.38
32 0.33
33 0.31
34 0.27
35 0.19
36 0.17
37 0.14
38 0.09
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.09
53 0.08
54 0.09
55 0.11
56 0.17
57 0.19
58 0.22
59 0.22
60 0.2
61 0.23
62 0.25
63 0.26
64 0.24
65 0.25
66 0.25
67 0.27
68 0.27
69 0.24
70 0.23
71 0.22
72 0.19
73 0.18
74 0.18
75 0.2
76 0.27
77 0.3
78 0.33
79 0.4
80 0.48
81 0.55
82 0.63
83 0.69
84 0.72
85 0.78
86 0.85
87 0.85
88 0.87
89 0.88
90 0.89
91 0.87
92 0.82
93 0.75
94 0.64
95 0.56
96 0.48
97 0.37
98 0.31
99 0.24
100 0.2
101 0.18