Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C8R8

Protein Details
Accession A0A095C8R8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-129SSRKPICPPSPKLRTKKQRARSYTIHHydrophilic
NLS Segment(s)
PositionSequence
115-120KLRTKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAASKRPFADPGPSNKEYPPPSQSDFSDSETEVDSDKETVASSFGNAEKEKIAPAPLRYPLRTMEAKKTDDTDSDVSGDDYSTDTTAIESDTKSESWKNRSKVSSRKPICPPSPKLRTKKQRARSYTIHIFSDLQYGRAVAEIAPGAGKAHGHGGVGNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.53
4 0.48
5 0.48
6 0.43
7 0.4
8 0.42
9 0.43
10 0.43
11 0.41
12 0.4
13 0.38
14 0.35
15 0.3
16 0.26
17 0.24
18 0.23
19 0.18
20 0.16
21 0.13
22 0.1
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.09
31 0.1
32 0.13
33 0.13
34 0.14
35 0.14
36 0.14
37 0.15
38 0.13
39 0.15
40 0.14
41 0.17
42 0.19
43 0.25
44 0.28
45 0.28
46 0.29
47 0.27
48 0.3
49 0.32
50 0.32
51 0.34
52 0.36
53 0.37
54 0.36
55 0.37
56 0.33
57 0.29
58 0.29
59 0.22
60 0.17
61 0.16
62 0.15
63 0.13
64 0.12
65 0.11
66 0.07
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.06
78 0.08
79 0.08
80 0.09
81 0.13
82 0.17
83 0.25
84 0.32
85 0.35
86 0.4
87 0.45
88 0.51
89 0.57
90 0.62
91 0.65
92 0.61
93 0.66
94 0.68
95 0.71
96 0.72
97 0.71
98 0.69
99 0.68
100 0.74
101 0.75
102 0.75
103 0.77
104 0.8
105 0.83
106 0.86
107 0.86
108 0.86
109 0.84
110 0.84
111 0.8
112 0.78
113 0.77
114 0.7
115 0.61
116 0.52
117 0.46
118 0.39
119 0.4
120 0.31
121 0.23
122 0.19
123 0.18
124 0.16
125 0.16
126 0.15
127 0.07
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.07
137 0.11
138 0.11
139 0.11