Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C8Y4

Protein Details
Accession A0A095C8Y4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-99SKLSKAPKATKSPRSLKLPKAPKQSKAGKPYKTRKPIKPPKASVPPETHydrophilic
NLS Segment(s)
PositionSequence
55-92SKAPKATKSPRSLKLPKAPKQSKAGKPYKTRKPIKPPK
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000999  RNase_III_dom  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF00636  Ribonuclease_3  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
PS50142  RNASE_3_2  
CDD cd00593  RIBOc  
Amino Acid Sequences MLQTALRRGTFHTTAITCTPAASRTPPPALLSFSCHFSLLCKSLQPQQSTLSKLSKAPKATKSPRSLKLPKAPKQSKAGKPYKTRKPIKPPKASVPPETQVTTELPISGEVPISPKYPTAFKNLTSSRHPPFDKLFIMVRAADIVNRMEMPEELPDFPLPPLPDIYDRELLRQVFTHSSYVGARKQSALFDKEAFHHDNEKLEHVGDALLGCIVTCLLHDLYPNLNPGNATEMKAICVCNQTLSQLSRRYKMPERLITDVNATEVLKNGTKTTANIFEAYVAGLHYSYLKHGNTKDVDEGDGPKTHGQGLEHLQEWLRPLFEPIAEWVLGYMKKEQERLEAETAVKAGSMDTDLDGLANGASGKLNELFISRGAGMPVYTYEPWGVDMWKAIVIARNRDGKEWQGEATRTKKKQAATVAAYKVLMQLDVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.25
5 0.23
6 0.23
7 0.19
8 0.21
9 0.22
10 0.25
11 0.3
12 0.34
13 0.35
14 0.36
15 0.37
16 0.39
17 0.36
18 0.37
19 0.32
20 0.32
21 0.3
22 0.28
23 0.25
24 0.23
25 0.27
26 0.24
27 0.24
28 0.23
29 0.25
30 0.33
31 0.4
32 0.4
33 0.36
34 0.4
35 0.43
36 0.45
37 0.47
38 0.44
39 0.4
40 0.42
41 0.47
42 0.47
43 0.49
44 0.53
45 0.56
46 0.62
47 0.69
48 0.73
49 0.75
50 0.78
51 0.79
52 0.81
53 0.8
54 0.79
55 0.8
56 0.8
57 0.79
58 0.81
59 0.8
60 0.76
61 0.78
62 0.78
63 0.77
64 0.77
65 0.78
66 0.76
67 0.8
68 0.83
69 0.85
70 0.85
71 0.86
72 0.85
73 0.88
74 0.9
75 0.9
76 0.91
77 0.86
78 0.86
79 0.87
80 0.82
81 0.76
82 0.73
83 0.65
84 0.58
85 0.53
86 0.43
87 0.34
88 0.31
89 0.26
90 0.19
91 0.16
92 0.13
93 0.12
94 0.12
95 0.1
96 0.09
97 0.07
98 0.1
99 0.11
100 0.11
101 0.11
102 0.12
103 0.13
104 0.18
105 0.2
106 0.25
107 0.26
108 0.27
109 0.36
110 0.38
111 0.41
112 0.42
113 0.46
114 0.43
115 0.48
116 0.47
117 0.42
118 0.42
119 0.43
120 0.38
121 0.34
122 0.32
123 0.26
124 0.26
125 0.23
126 0.19
127 0.15
128 0.14
129 0.11
130 0.1
131 0.1
132 0.09
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.09
139 0.1
140 0.1
141 0.11
142 0.11
143 0.12
144 0.12
145 0.14
146 0.12
147 0.11
148 0.12
149 0.12
150 0.15
151 0.17
152 0.21
153 0.23
154 0.23
155 0.24
156 0.27
157 0.26
158 0.23
159 0.21
160 0.2
161 0.17
162 0.18
163 0.17
164 0.13
165 0.14
166 0.15
167 0.17
168 0.18
169 0.17
170 0.16
171 0.17
172 0.18
173 0.2
174 0.22
175 0.22
176 0.2
177 0.2
178 0.21
179 0.21
180 0.24
181 0.23
182 0.2
183 0.22
184 0.21
185 0.22
186 0.22
187 0.22
188 0.18
189 0.16
190 0.15
191 0.11
192 0.1
193 0.07
194 0.06
195 0.04
196 0.04
197 0.03
198 0.03
199 0.03
200 0.03
201 0.02
202 0.02
203 0.04
204 0.04
205 0.05
206 0.05
207 0.07
208 0.08
209 0.1
210 0.11
211 0.09
212 0.09
213 0.09
214 0.09
215 0.13
216 0.13
217 0.13
218 0.14
219 0.14
220 0.14
221 0.16
222 0.16
223 0.12
224 0.13
225 0.12
226 0.11
227 0.11
228 0.12
229 0.14
230 0.15
231 0.19
232 0.25
233 0.27
234 0.29
235 0.3
236 0.35
237 0.39
238 0.46
239 0.49
240 0.48
241 0.5
242 0.51
243 0.5
244 0.45
245 0.4
246 0.31
247 0.24
248 0.18
249 0.14
250 0.1
251 0.09
252 0.1
253 0.1
254 0.11
255 0.11
256 0.12
257 0.12
258 0.13
259 0.16
260 0.19
261 0.19
262 0.19
263 0.19
264 0.17
265 0.16
266 0.15
267 0.12
268 0.06
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.07
275 0.12
276 0.12
277 0.17
278 0.18
279 0.24
280 0.25
281 0.27
282 0.29
283 0.25
284 0.25
285 0.23
286 0.24
287 0.21
288 0.2
289 0.19
290 0.18
291 0.17
292 0.17
293 0.17
294 0.15
295 0.17
296 0.2
297 0.22
298 0.21
299 0.21
300 0.2
301 0.19
302 0.21
303 0.17
304 0.14
305 0.11
306 0.12
307 0.13
308 0.13
309 0.13
310 0.12
311 0.14
312 0.13
313 0.13
314 0.11
315 0.13
316 0.14
317 0.14
318 0.16
319 0.19
320 0.21
321 0.25
322 0.26
323 0.3
324 0.33
325 0.37
326 0.37
327 0.34
328 0.32
329 0.3
330 0.29
331 0.22
332 0.18
333 0.12
334 0.09
335 0.07
336 0.07
337 0.07
338 0.07
339 0.07
340 0.07
341 0.07
342 0.07
343 0.06
344 0.05
345 0.05
346 0.05
347 0.05
348 0.05
349 0.05
350 0.07
351 0.08
352 0.09
353 0.09
354 0.1
355 0.11
356 0.11
357 0.14
358 0.12
359 0.12
360 0.12
361 0.12
362 0.11
363 0.11
364 0.12
365 0.13
366 0.13
367 0.13
368 0.14
369 0.14
370 0.16
371 0.16
372 0.15
373 0.12
374 0.13
375 0.13
376 0.14
377 0.14
378 0.13
379 0.18
380 0.21
381 0.27
382 0.31
383 0.38
384 0.38
385 0.41
386 0.44
387 0.44
388 0.46
389 0.42
390 0.39
391 0.38
392 0.4
393 0.44
394 0.51
395 0.55
396 0.52
397 0.57
398 0.58
399 0.55
400 0.59
401 0.62
402 0.62
403 0.59
404 0.64
405 0.6
406 0.58
407 0.54
408 0.47
409 0.4
410 0.31