Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6DHY9

Protein Details
Accession A0A0L6DHY9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-148LLIYWLLRRKKRQGVKKGFWQGKAHydrophilic
NLS Segment(s)
PositionSequence
132-141RRKKRQGVKK
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, plas 5, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MGFLDGNDDASSAISQQTSAAKETIKTSAKAAATSKASADDNNDKATSAVAAITSAPQTSKAAETSVATAATSETLGSNSSNGVADTVSTCINQGLDSAGCRSGRAANEGAIIGGAVAGVIIIGLLIYWLLRRKKRQGVKKGFWQGKAMGGSGPSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.13
5 0.14
6 0.16
7 0.17
8 0.16
9 0.18
10 0.2
11 0.26
12 0.25
13 0.25
14 0.24
15 0.29
16 0.29
17 0.3
18 0.29
19 0.27
20 0.26
21 0.26
22 0.25
23 0.22
24 0.22
25 0.2
26 0.24
27 0.25
28 0.24
29 0.26
30 0.26
31 0.23
32 0.22
33 0.22
34 0.16
35 0.09
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.1
52 0.1
53 0.11
54 0.09
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.1
87 0.1
88 0.1
89 0.11
90 0.13
91 0.14
92 0.17
93 0.17
94 0.15
95 0.16
96 0.16
97 0.15
98 0.1
99 0.09
100 0.05
101 0.04
102 0.03
103 0.02
104 0.02
105 0.02
106 0.01
107 0.01
108 0.01
109 0.01
110 0.01
111 0.01
112 0.01
113 0.02
114 0.02
115 0.04
116 0.11
117 0.18
118 0.25
119 0.33
120 0.43
121 0.53
122 0.63
123 0.72
124 0.77
125 0.81
126 0.83
127 0.86
128 0.88
129 0.85
130 0.78
131 0.72
132 0.62
133 0.57
134 0.51
135 0.4
136 0.31
137 0.25