Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F8S3

Protein Details
Accession A7F8S3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-38IDGRRGRKEGKRRLKGWRVEEBasic
76-95EEKGRKRKGGREREEEKGRKBasic
NLS Segment(s)
PositionSequence
21-34RRGRKEGKRRLKGW
63-96TRIEELRRGREREEEKGRKRKGGREREEEKGRKS
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG ssl:SS1G_14004  -  
Amino Acid Sequences MSDLHGFNLHSLLRDCSIDGRRGRKEGKRRLKGWRVEESKNGESEESNSGIEQRETGIEERKTRIEELRRGREREEEKGRKRKGGREREEEKGRKSCRLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.24
5 0.29
6 0.33
7 0.38
8 0.41
9 0.47
10 0.53
11 0.55
12 0.62
13 0.67
14 0.72
15 0.74
16 0.75
17 0.79
18 0.81
19 0.8
20 0.76
21 0.76
22 0.7
23 0.64
24 0.64
25 0.61
26 0.54
27 0.46
28 0.4
29 0.3
30 0.25
31 0.24
32 0.2
33 0.14
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.08
40 0.06
41 0.06
42 0.07
43 0.09
44 0.14
45 0.16
46 0.18
47 0.2
48 0.22
49 0.23
50 0.23
51 0.29
52 0.3
53 0.36
54 0.43
55 0.52
56 0.56
57 0.57
58 0.57
59 0.6
60 0.57
61 0.58
62 0.6
63 0.59
64 0.63
65 0.71
66 0.73
67 0.73
68 0.74
69 0.74
70 0.74
71 0.75
72 0.74
73 0.74
74 0.76
75 0.77
76 0.82
77 0.79
78 0.76
79 0.74
80 0.69
81 0.69