Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C8Z6

Protein Details
Accession A0A095C8Z6   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-76IQIYTVPRKSKQRKLPKSKSAPPLTYHydrophilic
NLS Segment(s)
PositionSequence
58-69RKSKQRKLPKSK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKYKDSISFQRYLYITNLPPGFLPAHLSQILAYPLKPNERRRRRYTGVKLIQIYTVPRKSKQRKLPKSKSAPPLTYQIQKTLIILELSDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.29
4 0.29
5 0.23
6 0.23
7 0.23
8 0.21
9 0.15
10 0.19
11 0.13
12 0.17
13 0.16
14 0.16
15 0.14
16 0.15
17 0.17
18 0.13
19 0.13
20 0.12
21 0.14
22 0.21
23 0.28
24 0.36
25 0.45
26 0.55
27 0.63
28 0.67
29 0.74
30 0.73
31 0.77
32 0.76
33 0.76
34 0.72
35 0.69
36 0.63
37 0.54
38 0.49
39 0.39
40 0.33
41 0.29
42 0.29
43 0.27
44 0.3
45 0.4
46 0.48
47 0.56
48 0.64
49 0.69
50 0.74
51 0.83
52 0.89
53 0.89
54 0.9
55 0.9
56 0.89
57 0.86
58 0.79
59 0.7
60 0.67
61 0.61
62 0.59
63 0.52
64 0.46
65 0.41
66 0.38
67 0.36
68 0.3
69 0.27
70 0.2